(data stored in ACNUC7421 zone)

EMBL: CP001720.PE328

CP001720.PE328       Location/Qualifiers
FT   CDS             complement(351660..352802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0340"
FT                   /product="Metal-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61293"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:C8W439"
FT                   /inference="protein motif:COG:COG5643"
FT                   /protein_id="ACV61293.1"
FT                   /translation="MRKTTAVCVLLCMLFVLPGLVLAQGTTADIENLVGKGKVTSLHLL
FT                   GVKATNIAMQQLSFTKGDANVLAMTDAGYSIISGQTTEKCIDGVIAASGCTTGGSNLLM
FT                   IHRSKELPLWFAFFKEDTRDFIYLQVNSAVVNKSVDELNKLADNQIFNIIAKENIKLDD
FT                   LYNNPDKWNEKINNKVFGGNESSLIGIASIWAHPKCTFDFLQAAQFHNHICPGVNSGYL
FT                   ISKYLDKNLPLQQGQSYKIFAVPSWCKDDALQVIYDATVGKKGMFASDLTEEQKKMLPD
FT                   NAKGVAGIYIRWDAKTNTGSGLVLAFDFDKASELAGVQNAAGPFVKLKTALTMMDYVNQ
FT                   PEIMVSTLKQFNVASAEELTALQAAGVNPLIKLGIMEEVK"
     MRKTTAVCVL LCMLFVLPGL VLAQGTTADI ENLVGKGKVT SLHLLGVKAT NIAMQQLSFT        60
     KGDANVLAMT DAGYSIISGQ TTEKCIDGVI AASGCTTGGS NLLMIHRSKE LPLWFAFFKE       120
     DTRDFIYLQV NSAVVNKSVD ELNKLADNQI FNIIAKENIK LDDLYNNPDK WNEKINNKVF       180
     GGNESSLIGI ASIWAHPKCT FDFLQAAQFH NHICPGVNSG YLISKYLDKN LPLQQGQSYK       240
     IFAVPSWCKD DALQVIYDAT VGKKGMFASD LTEEQKKMLP DNAKGVAGIY IRWDAKTNTG       300
     SGLVLAFDFD KASELAGVQN AAGPFVKLKT ALTMMDYVNQ PEIMVSTLKQ FNVASAEELT       360
     ALQAAGVNPL IKLGIMEEVK                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page