(data stored in ACNUC7421 zone)

EMBL: CP001720.PE329

CP001720.PE329       Location/Qualifiers
FT   CDS             complement(352845..353297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0341"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   dal:Dalk_5286 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61294"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:C8W440"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ACV61294.1"
FT                   /translation="MVNYILKPIGRIISDYKEKSQAPFQGRFKENISYLEINQEYMAGL
FT                   KDIETVSHIIVLYWGHLSDRETLLAKTPFGEEPRGVFSCRSPNRPNPVAVCVAQLLEVK
FT                   DNILKVKGVDALDQSPLLDIKPYSNKVDMVPDACIGWLESVQSAKQ"
     MVNYILKPIG RIISDYKEKS QAPFQGRFKE NISYLEINQE YMAGLKDIET VSHIIVLYWG        60
     HLSDRETLLA KTPFGEEPRG VFSCRSPNRP NPVAVCVAQL LEVKDNILKV KGVDALDQSP       120
     LLDIKPYSNK VDMVPDACIG WLESVQSAKQ                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page