(data stored in ACNUC7421 zone)

EMBL: CP001720.PE332

CP001720.PE332       Location/Qualifiers
FT   CDS             356661..357632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0344"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL110455 putative
FT                   substrate-binding component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61297"
FT                   /db_xref="GOA:C8W443"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W443"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61297.1"
FT                   /translation="MHKSSFAINYLIAFLIIISANFALPRLMPGDPLQAIYGDEALTAM
FT                   TPELKAELTRRFSLDQSWNEQFTAYIASLLRGDLGYSYYYNTPVTKVILGSLPWTFLLA
FT                   GPALLLSTLLGLILGIESGYRRGRVLDKTLLAGLMFISGFPDFFIGILMLLLFGVMLNL
FT                   VPLAGALTPYAGETGLALVLDVLWHLALPLAALLLVRLTSTYLFTRNTVITTLGEAFIL
FT                   TARAKGCPSGVIKYRHAGRNSLLPVVTAASLQLAHLITGTLFIEIIFSYPGVGTLLYSS
FT                   LLTRDYPLLQGILLTVTVIVLLINFFMDLLYKKLDPRINYAH"
     MHKSSFAINY LIAFLIIISA NFALPRLMPG DPLQAIYGDE ALTAMTPELK AELTRRFSLD        60
     QSWNEQFTAY IASLLRGDLG YSYYYNTPVT KVILGSLPWT FLLAGPALLL STLLGLILGI       120
     ESGYRRGRVL DKTLLAGLMF ISGFPDFFIG ILMLLLFGVM LNLVPLAGAL TPYAGETGLA       180
     LVLDVLWHLA LPLAALLLVR LTSTYLFTRN TVITTLGEAF ILTARAKGCP SGVIKYRHAG       240
     RNSLLPVVTA ASLQLAHLIT GTLFIEIIFS YPGVGTLLYS SLLTRDYPLL QGILLTVTVI       300
     VLLINFFMDL LYKKLDPRIN YAH                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page