(data stored in ACNUC7421 zone)

EMBL: CP001720.PE335

CP001720.PE335       Location/Qualifiers
FT   CDS             complement(360406..361368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0347"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0571 oligopeptide ABC
FT                   transporter ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61300"
FT                   /db_xref="GOA:C8W4U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61300.1"
FT                   /translation="MSLLEINNITKTFSLGNKFLKTNQSIAAVKDISLSLEEGCCLGIV
FT                   GESGCGKTTLGKIILGLEKPERGEVFFLGKDIYQTTGRELKELRRNLQVVFQDSLSAVN
FT                   PRLPIGKIISEPIRNYRKLTPSEEKKQVLELLEIVGLSPADIDKYPHQFSGGQIQRVTI
FT                   ARAIALKPKLIVLDEAVASLDMSVQAQILNLLLDLKEEFKLSYIFISHDILAVNYISDR
FT                   LAVMYMGKVVELIEDIRLIDELRHPYSIKLLSSVLSDHPRHRKKLSSSFDEPAISENGS
FT                   YGCSYFTRCEKASVLCREQTPLLSSLKEKHKVACPYCTR"
     MSLLEINNIT KTFSLGNKFL KTNQSIAAVK DISLSLEEGC CLGIVGESGC GKTTLGKIIL        60
     GLEKPERGEV FFLGKDIYQT TGRELKELRR NLQVVFQDSL SAVNPRLPIG KIISEPIRNY       120
     RKLTPSEEKK QVLELLEIVG LSPADIDKYP HQFSGGQIQR VTIARAIALK PKLIVLDEAV       180
     ASLDMSVQAQ ILNLLLDLKE EFKLSYIFIS HDILAVNYIS DRLAVMYMGK VVELIEDIRL       240
     IDELRHPYSI KLLSSVLSDH PRHRKKLSSS FDEPAISENG SYGCSYFTRC EKASVLCREQ       300
     TPLLSSLKEK HKVACPYCTR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page