(data stored in ACNUC7421 zone)

EMBL: CP001720.PE338

CP001720.PE338       Location/Qualifiers
FT   CDS             complement(363208..364140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0350"
FT                   /product="nickel ABC transporter, permease subunit NikB"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikB; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_7614 nickel ABC
FT                   transporter permease subunit NikB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61303"
FT                   /db_xref="GOA:C8W4V1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V1"
FT                   /inference="protein motif:TFAM:TIGR02789"
FT                   /protein_id="ACV61303.1"
FT                   /translation="MKKYIFRRLLNIIPVLLGISVITFGLIHMVPCDPAEVYLRLSQIP
FT                   PTDEAVALVRSELGLDRPLYIQYFDWLWKVFHLDFGKSFVTRQPVLPSVLYYIPATIQL
FT                   TACSLLLMFLISIPLGIWAALYKDSLLDQFSRILAFIGASMPSFWLGFLLLYVFSLKLD
FT                   LLPVTGRGTFLHLILPSLTLALGYAATYTRLLRTSMLENLNKDFVLYARVRGIKEKLII
FT                   GKHVFKNALLPMITAFGMSLGHLLAGSVIVENIFAWPGVGRYCVFSIFSRDYPVIQCYV
FT                   CLMAVIFVVCNLLVDIAYVYLDPRIKIGR"
     MKKYIFRRLL NIIPVLLGIS VITFGLIHMV PCDPAEVYLR LSQIPPTDEA VALVRSELGL        60
     DRPLYIQYFD WLWKVFHLDF GKSFVTRQPV LPSVLYYIPA TIQLTACSLL LMFLISIPLG       120
     IWAALYKDSL LDQFSRILAF IGASMPSFWL GFLLLYVFSL KLDLLPVTGR GTFLHLILPS       180
     LTLALGYAAT YTRLLRTSML ENLNKDFVLY ARVRGIKEKL IIGKHVFKNA LLPMITAFGM       240
     SLGHLLAGSV IVENIFAWPG VGRYCVFSIF SRDYPVIQCY VCLMAVIFVV CNLLVDIAYV       300
     YLDPRIKIGR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page