(data stored in ACNUC7421 zone)

EMBL: CP001720.PE34

CP001720.PE34        Location/Qualifiers
FT   CDS             37173..37316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60999"
FT                   /db_xref="GOA:C8VVC3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV60999.1"
FT                   /translation="MQIYTLFRVILYLVYGTCLRIVIVFYVISGLFLIRKYNTVLAVID
FT                   SN"
     MQIYTLFRVI LYLVYGTCLR IVIVFYVISG LFLIRKYNTV LAVIDSN                      47
//

If you have problems or comments...

PBIL Back to PBIL home page