(data stored in ACNUC7421 zone)

EMBL: CP001720.PE341

CP001720.PE341       Location/Qualifiers
FT   CDS             367315..369042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1962 ABC efflux pump, fused ATPase and
FT                   inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61306"
FT                   /db_xref="GOA:C8W4V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61306.1"
FT                   /translation="MNFYLRIFSLLKGSYLHIACKIAMGVLITATYVGQAFAIAAGLKG
FT                   VFYKKSLEDLGFVLLCIGLLVLLRALLHWLDEIYAKRIAFWVKSRLRERLFQHVMNLGP
FT                   GYQENCRSGSIQALLTDGVESLEPLLTGYIPQLLVAFFGSGLISLYIFSLDRVVGIIAL
FT                   TGIIITVLFPQLMSKYVGKIILEYWQSHARLNSQYIDAMQGMAALKMFNAGKKKGQELS
FT                   EEAWGHYRHSMQGLGISLLDSAVVKWAAAAGSTLAAGVGALRVSNGELPLADLFIILFL
FT                   SVECFRPLNELVMYWHRSFLGIAAVRGIFAIFDTNISIQDQEDFNGDNNVCPYPEIDFK
FT                   NVTFSYAAGKRPAVKNVSLRVNPGETVAIVGKSGSGKSTMVNLLLRFFEQQEGSILLNG
FT                   RDIKDYPLSFLRSQIAVVFQDTYLFYGTVEDNLKIAKPGATREELEQAAKLANAHDFIM
FT                   NLKDGYRTHIGERGVRLSGGQKQRLSIARAVLKNAPLLILDEATSNVDGASEKMIQEAL
FT                   DKLVRNRTTIIIAHRLSTIKGADRIIVLDDHRVKETGTHSELLGFGGIYAQLVRLQQG"
     MNFYLRIFSL LKGSYLHIAC KIAMGVLITA TYVGQAFAIA AGLKGVFYKK SLEDLGFVLL        60
     CIGLLVLLRA LLHWLDEIYA KRIAFWVKSR LRERLFQHVM NLGPGYQENC RSGSIQALLT       120
     DGVESLEPLL TGYIPQLLVA FFGSGLISLY IFSLDRVVGI IALTGIIITV LFPQLMSKYV       180
     GKIILEYWQS HARLNSQYID AMQGMAALKM FNAGKKKGQE LSEEAWGHYR HSMQGLGISL       240
     LDSAVVKWAA AAGSTLAAGV GALRVSNGEL PLADLFIILF LSVECFRPLN ELVMYWHRSF       300
     LGIAAVRGIF AIFDTNISIQ DQEDFNGDNN VCPYPEIDFK NVTFSYAAGK RPAVKNVSLR       360
     VNPGETVAIV GKSGSGKSTM VNLLLRFFEQ QEGSILLNGR DIKDYPLSFL RSQIAVVFQD       420
     TYLFYGTVED NLKIAKPGAT REELEQAAKL ANAHDFIMNL KDGYRTHIGE RGVRLSGGQK       480
     QRLSIARAVL KNAPLLILDE ATSNVDGASE KMIQEALDKL VRNRTTIIIA HRLSTIKGAD       540
     RIIVLDDHRV KETGTHSELL GFGGIYAQLV RLQQG                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page