(data stored in ACNUC7421 zone)

EMBL: CP001720.PE343

CP001720.PE343       Location/Qualifiers
FT   CDS             371174..371854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0355"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   swi:Swit_3743 1-Cys peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61308"
FT                   /db_xref="GOA:C8W4V6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V6"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ACV61308.1"
FT                   /translation="MDSMSESFRMPLIGDDAPVFTAKTTMGDINFPADYKGKWVIFFSH
FT                   PADFTPVCTTEFMTFATMQEELKKLNTELIGLSIDSIYAHIAWLRTIKDKIEYKGMKNV
FT                   EVLFPLIEDLKMDVAKKFGMVQPNASTTQAVRAVFIIDPNSKVRAILYYPLTTGRNMEE
FT                   IKRMIIAMQKSDSDGVATPANWVPGDDVIIPPPGSCGSAKERMESQEEGKYCLDWFMCF
FT                   RKEK"
     MDSMSESFRM PLIGDDAPVF TAKTTMGDIN FPADYKGKWV IFFSHPADFT PVCTTEFMTF        60
     ATMQEELKKL NTELIGLSID SIYAHIAWLR TIKDKIEYKG MKNVEVLFPL IEDLKMDVAK       120
     KFGMVQPNAS TTQAVRAVFI IDPNSKVRAI LYYPLTTGRN MEEIKRMIIA MQKSDSDGVA       180
     TPANWVPGDD VIIPPPGSCG SAKERMESQE EGKYCLDWFM CFRKEK                      226
//

If you have problems or comments...

PBIL Back to PBIL home page