(data stored in ACNUC7421 zone)

EMBL: CP001720.PE345

CP001720.PE345       Location/Qualifiers
FT   CDS             373598..373741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61310"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61310.1"
FT                   /translation="MYLKVFVRSDLKVRYFRNCLPILALAGVYELLETDPFYASNHKAS
FT                   EG"
     MYLKVFVRSD LKVRYFRNCL PILALAGVYE LLETDPFYAS NHKASEG                      47
//

If you have problems or comments...

PBIL Back to PBIL home page