(data stored in ACNUC7421 zone)

EMBL: CP001720.PE346

CP001720.PE346       Location/Qualifiers
FT   CDS             complement(373749..375461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0359"
FT                   /product="transposase-like protein"
FT                   /note="KEGG: dal:Dalk_3879 transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61311"
FT                   /db_xref="UniProtKB/TrEMBL:C8VXG4"
FT                   /inference="similar to AA sequence:KEGG:Dalk_3879"
FT                   /protein_id="ACV61311.1"
FT                   /translation="MASIIKKKKKNQFYYYLVESARVNGKPRIVRQKYLGRAEDIAKAV
FT                   EGKSDLENPKYSIVLEFGTVCALYDIAKQLGVIEIIDKYAPKREQGLSVGEYMLLAAIN
FT                   RVVKPVSKFQIGEWYDKTMLYRMLPAPKQSLTSQRFWDNMSLLSDSAIESFENEFTQLI
FT                   VDKYNLSTDLLIYDATNFFTYIDTLSADKLPQRGHSKEKRSDLKIVGLAMMVTPDFNVP
FT                   LFYDVYPGNDNDSVEFKAVIEKLKNRYINICGKPGNATLVFDKGNNSLNNMDLVMSGEF
FT                   AFNVVGSLRLSQNKSLLDIPIQEYESVNSDNFRNVKAYRTTLSVYNREMTVLVVCNPEL
FT                   FAGQMQSIAINIEKCTLKLRVLQKSLLDRVAGVTTKGRKPTVTSVQKNVATILHGEFMS
FT                   DIFDVQIYEQDGLAHLDFSINIKQFNYVKEHFLGKTVLFTDNHDWPNDKIISTYRSQYH
FT                   IEDDFRQMKDTTFLGFRPIHHWTDQKIKVHAFYCVLALRLCCLLNRVLHENGLKMSINK
FT                   MLSRLSDIKQVITVYPKKGNSKKDRECFSLTKISAEEKRLLEVLDIGKYALGG"
     MASIIKKKKK NQFYYYLVES ARVNGKPRIV RQKYLGRAED IAKAVEGKSD LENPKYSIVL        60
     EFGTVCALYD IAKQLGVIEI IDKYAPKREQ GLSVGEYMLL AAINRVVKPV SKFQIGEWYD       120
     KTMLYRMLPA PKQSLTSQRF WDNMSLLSDS AIESFENEFT QLIVDKYNLS TDLLIYDATN       180
     FFTYIDTLSA DKLPQRGHSK EKRSDLKIVG LAMMVTPDFN VPLFYDVYPG NDNDSVEFKA       240
     VIEKLKNRYI NICGKPGNAT LVFDKGNNSL NNMDLVMSGE FAFNVVGSLR LSQNKSLLDI       300
     PIQEYESVNS DNFRNVKAYR TTLSVYNREM TVLVVCNPEL FAGQMQSIAI NIEKCTLKLR       360
     VLQKSLLDRV AGVTTKGRKP TVTSVQKNVA TILHGEFMSD IFDVQIYEQD GLAHLDFSIN       420
     IKQFNYVKEH FLGKTVLFTD NHDWPNDKII STYRSQYHIE DDFRQMKDTT FLGFRPIHHW       480
     TDQKIKVHAF YCVLALRLCC LLNRVLHENG LKMSINKMLS RLSDIKQVIT VYPKKGNSKK       540
     DRECFSLTKI SAEEKRLLEV LDIGKYALGG                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page