(data stored in ACNUC7421 zone)

EMBL: CP001720.PE349

CP001720.PE349       Location/Qualifiers
FT   CDS             377977..379047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0362"
FT                   /product="O-methyltransferase family 2"
FT                   /note="PFAM: O-methyltransferase family 2; KEGG:
FT                   sus:Acid_0820 hydroxyneurosporene-O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61314"
FT                   /db_xref="GOA:C8W4W2"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W2"
FT                   /inference="protein motif:PFAM:PF00891"
FT                   /protein_id="ACV61314.1"
FT                   /translation="MTKIPLDIGDYADIKPVYDMLNNCAEGFKKYCILLTAVEIGIFDR
FT                   LVVPQTIRDISHELKTDLNIISNVCEALKIMGLVFERSGLYENTEISNLFLRTDSPLAQ
FT                   HNVLKNLQSGLRLWENLPKILKEGPITLSEEKFFANNLIHSLADEALCGELQRTVSIIA
FT                   ELPEFKKAKRLLDLGGGHGLYAIAFTKINPDLVAHVYDFPGVIDDTRKYIEKYEAERVK
FT                   VISGNFFADDIGEEYDVIFFSSNPGGKNPRIVPRIYESLKKNGLFINKHCFYSKGEGSK
FT                   NILLDIEWNLTTFEGVQKGNKVYTFNGDLFYDEYIELLEKYFSIINIVDSPDFTGYPLS
FT                   KIGDTLDSKIIIASRC"
     MTKIPLDIGD YADIKPVYDM LNNCAEGFKK YCILLTAVEI GIFDRLVVPQ TIRDISHELK        60
     TDLNIISNVC EALKIMGLVF ERSGLYENTE ISNLFLRTDS PLAQHNVLKN LQSGLRLWEN       120
     LPKILKEGPI TLSEEKFFAN NLIHSLADEA LCGELQRTVS IIAELPEFKK AKRLLDLGGG       180
     HGLYAIAFTK INPDLVAHVY DFPGVIDDTR KYIEKYEAER VKVISGNFFA DDIGEEYDVI       240
     FFSSNPGGKN PRIVPRIYES LKKNGLFINK HCFYSKGEGS KNILLDIEWN LTTFEGVQKG       300
     NKVYTFNGDL FYDEYIELLE KYFSIINIVD SPDFTGYPLS KIGDTLDSKI IIASRC           356
//

If you have problems or comments...

PBIL Back to PBIL home page