(data stored in ACNUC7421 zone)

EMBL: CP001720.PE351

CP001720.PE351       Location/Qualifiers
FT   CDS             complement(382404..382877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0367"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dat:HRM2_46890 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61316"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W4"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACV61316.1"
FT                   /translation="MEGKVAISAFGNDAEAMYSPHFGAASHFVIYNLSTGETEVVENVA
FT                   HNLSAGRGEMAARLLLEHGIKAVVTQLIGPRPFRTFQENGVNIYPGLRLMVEDITRAVQ
FT                   EERLSPPLSGPTEESHSGGECNSKNCSKCSEAASTSAQITENIKEEVKESEQG"
     MEGKVAISAF GNDAEAMYSP HFGAASHFVI YNLSTGETEV VENVAHNLSA GRGEMAARLL        60
     LEHGIKAVVT QLIGPRPFRT FQENGVNIYP GLRLMVEDIT RAVQEERLSP PLSGPTEESH       120
     SGGECNSKNC SKCSEAASTS AQITENIKEE VKESEQG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page