(data stored in ACNUC7421 zone)

EMBL: CP001720.PE354

CP001720.PE354       Location/Qualifiers
FT   CDS             384829..385683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0370"
FT                   /product="nickel ABC transporter, permease subunit NikC"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikC; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0569 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61319"
FT                   /db_xref="GOA:C8W4W7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014157"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W7"
FT                   /inference="protein motif:TFAM:TIGR02790"
FT                   /protein_id="ACV61319.1"
FT                   /translation="MSGKGLLGATLARLLKDRLALIGLGIIMLVFFTGVFAPFITPHDP
FT                   DEVKLEQILLPVTADYPLGTDHLGRCVLSRLIFGTRVSVSTSLLVLITIMLIGIPIGTL
FT                   SGYYGGRIDNFIMRIIDVLLAFPGLILTLVIAGMLGPNLINVMIALSAVWWVGYARVVR
FT                   GMVLSIKEKEYVLGARAAGTSNINILVRHIIPNVLSPVIVMATLDMGKLILAISSLSFL
FT                   GLGAQPPTPEWGAMLNDGKNYMQVAPNLMLFPGIAIMVLVLAFNLLGDGLRDAFDPRSS
FT                   TER"
     MSGKGLLGAT LARLLKDRLA LIGLGIIMLV FFTGVFAPFI TPHDPDEVKL EQILLPVTAD        60
     YPLGTDHLGR CVLSRLIFGT RVSVSTSLLV LITIMLIGIP IGTLSGYYGG RIDNFIMRII       120
     DVLLAFPGLI LTLVIAGMLG PNLINVMIAL SAVWWVGYAR VVRGMVLSIK EKEYVLGARA       180
     AGTSNINILV RHIIPNVLSP VIVMATLDMG KLILAISSLS FLGLGAQPPT PEWGAMLNDG       240
     KNYMQVAPNL MLFPGIAIMV LVLAFNLLGD GLRDAFDPRS STER                        284
//

If you have problems or comments...

PBIL Back to PBIL home page