(data stored in ACNUC7421 zone)

EMBL: CP001720.PE355

CP001720.PE355       Location/Qualifiers
FT   CDS             385763..386758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0371"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: avi:Avi_5352 ABC transporter nucleotide
FT                   binding/ATPase protein (oligopeptide); TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61320"
FT                   /db_xref="GOA:C8W4W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W8"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61320.1"
FT                   /translation="MLNNAVFQVNDLKTYFYTGSGVVKAVNGVSFQVQAGKTLCIVGES
FT                   GCGKSITLLSLLGLIEVPGKIISGEVYLNDRDILKLSSQELRKIRGKEISLIFQDPMTS
FT                   LNPVLKIGCQLTETILAHENCSKKEARDRSVSMLKKVGLPDPEKIMKRFSFQLSGGMRQ
FT                   RVMIAQALSLFPEVLIADEPTTALDVTVQAQILWELKKIQKEFNTALILVTHNLGVVAE
FT                   LADEVAVMYAGSIVEYGPVLNIFETPLHPYTQALLNSMPKFGYYHDLPVPIQGQPPNLL
FT                   NLPEQCAFAPRCSYVDNVCLGHKPGLTTINPGHKAACHKLKKPFKEGSVA"
     MLNNAVFQVN DLKTYFYTGS GVVKAVNGVS FQVQAGKTLC IVGESGCGKS ITLLSLLGLI        60
     EVPGKIISGE VYLNDRDILK LSSQELRKIR GKEISLIFQD PMTSLNPVLK IGCQLTETIL       120
     AHENCSKKEA RDRSVSMLKK VGLPDPEKIM KRFSFQLSGG MRQRVMIAQA LSLFPEVLIA       180
     DEPTTALDVT VQAQILWELK KIQKEFNTAL ILVTHNLGVV AELADEVAVM YAGSIVEYGP       240
     VLNIFETPLH PYTQALLNSM PKFGYYHDLP VPIQGQPPNL LNLPEQCAFA PRCSYVDNVC       300
     LGHKPGLTTI NPGHKAACHK LKKPFKEGSV A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page