(data stored in ACNUC7421 zone)

EMBL: CP001720.PE356

CP001720.PE356       Location/Qualifiers
FT   CDS             386755..387726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0372"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61321"
FT                   /db_xref="GOA:C8W4W9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61321.1"
FT                   /translation="MILLKVANLKKKYNTSFGHFSAAKEIVYAVEDISFSLRQGETLAL
FT                   AGESGCGKSTLARLILRLEEPTGGKIIFAGEDITNLSGKKLRHIRKNMQIVFQDSSSSL
FT                   NQLQTVGASIEEPLNNFQIRTPKDRKQRVEELMEMVGIDRGYINKYPHQLSGGQRQRVS
FT                   LARALAITPRLLVLDEPVSSLDVSIQAQILNLLENLKKEYNLTYLFISHDLAVISQISD
FT                   RIAIMYLGSIIEIIRCEDLLAEAVHPYTTDLLASVPVPDPRQRKDRRKTLMGEPPNPLN
FT                   PPAGCRFHPRCRLAWQVCRQEKPTLRLIENEHMVACHLYGNR"
     MILLKVANLK KKYNTSFGHF SAAKEIVYAV EDISFSLRQG ETLALAGESG CGKSTLARLI        60
     LRLEEPTGGK IIFAGEDITN LSGKKLRHIR KNMQIVFQDS SSSLNQLQTV GASIEEPLNN       120
     FQIRTPKDRK QRVEELMEMV GIDRGYINKY PHQLSGGQRQ RVSLARALAI TPRLLVLDEP       180
     VSSLDVSIQA QILNLLENLK KEYNLTYLFI SHDLAVISQI SDRIAIMYLG SIIEIIRCED       240
     LLAEAVHPYT TDLLASVPVP DPRQRKDRRK TLMGEPPNPL NPPAGCRFHP RCRLAWQVCR       300
     QEKPTLRLIE NEHMVACHLY GNR                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page