(data stored in ACNUC7421 zone)

EMBL: CP001720.PE358

CP001720.PE358       Location/Qualifiers
FT   CDS             complement(388989..391061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61323"
FT                   /db_xref="GOA:C8W4X1"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="InterPro:IPR033734"
FT                   /db_xref="InterPro:IPR036404"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61323.1"
FT                   /translation="MFTVEKIKSFGTSGGGEFSDPTDIMNNYILREIKITDDDNNVHGI
FT                   ECTWKDIQGKQHSEPRRGGQWGGLNEEIVILDPDEYICKIEGTIGTGWRPLLNRIRFTT
FT                   NKGNLFPKKKKYYGGATDGNNFTIDGLRLAGFYGRCGYGIDNIGFYSRVDKSEYLYFTD
FT                   FVKSHEYGGDGGNPFTDNPPTDVPTHLKEIEFKYGNDLNDIRCKCRNQNGKMYVGEEHS
FT                   GRWGDNYYIFLLDNDEVVTTVKGSLSKDKKGVRSLQLQTNKNRVSDIIGSNDGIDPFEI
FT                   KANTVGFFGRAGCSIDKIGVLSGVPVKLEYYRMSVWIAPTTIPGPIPIKGDHTWVTGSD
FT                   KSCWRGLGGNDPNYYCNPNRWTYNPNTNDYDYLPPPGCKGKLLEKGKGDMSKAALMAGR
FT                   EHNLVLIINGKPTNTGITMFHAGITYGLIGVCHQIANRVLLPSGITVDGAAGYNLSWWF
FT                   FDVYGTYWRYANYYAFIGVLYKMVKDKYPNENLFLIIAQIILIADNVTKDPRGEFIQRC
FT                   KDSGITPPIFAENKLLSQLFQLNDKYSPPTSARDSVIMHHSFHLEEVEIMLNYRNSKML
FT                   KPVSESVIRDIRDVIDQLLRPTDEEMAFSAALSHAANTNDLQSIGDLVSSNEYISNGVK
FT                   ALSQINSFALALQDKIEKILSPKDYEALFGYPSGERYYLINPFFFEKNYNTHIRN"
     MFTVEKIKSF GTSGGGEFSD PTDIMNNYIL REIKITDDDN NVHGIECTWK DIQGKQHSEP        60
     RRGGQWGGLN EEIVILDPDE YICKIEGTIG TGWRPLLNRI RFTTNKGNLF PKKKKYYGGA       120
     TDGNNFTIDG LRLAGFYGRC GYGIDNIGFY SRVDKSEYLY FTDFVKSHEY GGDGGNPFTD       180
     NPPTDVPTHL KEIEFKYGND LNDIRCKCRN QNGKMYVGEE HSGRWGDNYY IFLLDNDEVV       240
     TTVKGSLSKD KKGVRSLQLQ TNKNRVSDII GSNDGIDPFE IKANTVGFFG RAGCSIDKIG       300
     VLSGVPVKLE YYRMSVWIAP TTIPGPIPIK GDHTWVTGSD KSCWRGLGGN DPNYYCNPNR       360
     WTYNPNTNDY DYLPPPGCKG KLLEKGKGDM SKAALMAGRE HNLVLIINGK PTNTGITMFH       420
     AGITYGLIGV CHQIANRVLL PSGITVDGAA GYNLSWWFFD VYGTYWRYAN YYAFIGVLYK       480
     MVKDKYPNEN LFLIIAQIIL IADNVTKDPR GEFIQRCKDS GITPPIFAEN KLLSQLFQLN       540
     DKYSPPTSAR DSVIMHHSFH LEEVEIMLNY RNSKMLKPVS ESVIRDIRDV IDQLLRPTDE       600
     EMAFSAALSH AANTNDLQSI GDLVSSNEYI SNGVKALSQI NSFALALQDK IEKILSPKDY       660
     EALFGYPSGE RYYLINPFFF EKNYNTHIRN                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page