(data stored in ACNUC7421 zone)

EMBL: CP001720.PE36

CP001720.PE36        Location/Qualifiers
FT   CDS             complement(38143..38841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0037"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   mmr:Mmar10_2918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61001"
FT                   /db_xref="GOA:C8VVC7"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC7"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ACV61001.1"
FT                   /translation="MIYKVNALTEDNNGFAKTLLSDWLLLILIFLSLLAGYTVYPHLPE
FT                   RVATHWSLSGDVNGYSSRFWGAFGIPLMTGGLYCLLLFLPLIDPQKENYKKFAAAYKVI
FT                   RSLLVVFMFGIYTVIILNALGYDIPVKKITMLGVSLLFMVIGNFMGQIRQNYFVGIKTP
FT                   WTLASEEVWQKTHRLSGKIWVAAGFLGIAGTLIDKPAGRVLLIAALAIAVIIPVIYSYL
FT                   EYQKTHVRKV"
     MIYKVNALTE DNNGFAKTLL SDWLLLILIF LSLLAGYTVY PHLPERVATH WSLSGDVNGY        60
     SSRFWGAFGI PLMTGGLYCL LLFLPLIDPQ KENYKKFAAA YKVIRSLLVV FMFGIYTVII       120
     LNALGYDIPV KKITMLGVSL LFMVIGNFMG QIRQNYFVGI KTPWTLASEE VWQKTHRLSG       180
     KIWVAAGFLG IAGTLIDKPA GRVLLIAALA IAVIIPVIYS YLEYQKTHVR KV               232
//

If you have problems or comments...

PBIL Back to PBIL home page