(data stored in ACNUC7421 zone)

EMBL: CP001720.PE362

CP001720.PE362       Location/Qualifiers
FT   CDS             complement(396030..396563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61327"
FT                   /db_xref="GOA:C8W4X5"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61327.1"
FT                   /translation="MVINLIFLRDVIILLSYTVVIFYLTPRVVLITTGLILFIRTIYYL
FT                   SKNYVNEKSFRRVCDSLPNKLKNSNEKIDIIKKYILHTKAFKGIFVGIISIILGYFNVP
FT                   LFKNELEQFLLGNYFPLPTLIITVALINNLNYKNDLIIIKRKLSGDSTIWLELTLILLA
FT                   VVILIALTSRTIPN"
     MVINLIFLRD VIILLSYTVV IFYLTPRVVL ITTGLILFIR TIYYLSKNYV NEKSFRRVCD        60
     SLPNKLKNSN EKIDIIKKYI LHTKAFKGIF VGIISIILGY FNVPLFKNEL EQFLLGNYFP       120
     LPTLIITVAL INNLNYKNDL IIIKRKLSGD STIWLELTLI LLAVVILIAL TSRTIPN          177
//

If you have problems or comments...

PBIL Back to PBIL home page