(data stored in ACNUC7421 zone)

EMBL: CP001720.PE363

CP001720.PE363       Location/Qualifiers
FT   CDS             complement(397470..399284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0383"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   shn:Shewana3_3655 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61328"
FT                   /db_xref="GOA:C8W4X6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X6"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV61328.1"
FT                   /translation="MDLQPILEQLAKLPPEALMKIMPELKVEVPKANPSGAVLIGVFLA
FT                   RSLGIGKIIDDFIDEEYVTYEHLREERSNGSNCRVSTGLACEIMIGDMLGRNKDLTRLY
FT                   KFEEACENWQVETILGIPAKKFNDDKMGRALDTLNSNAKYMANVLQDVVLSASKRFDIP
FT                   LNTFYNDTSSVPVYGDMENNDKVQYGYGGMPGLKQLILNLTISAGASLPVTSTIDPGNV
FT                   QGGNTFERSFEKVKEITDGQEFEMIIDRGILTQDNMHLMLTNSNKKALFIGPLKDELSK
FT                   NWVLEQLDNTEKDDFVSIEYRSKKEIERNLTKHYVAFETEYTFKVEIDPLSKDKKDKKR
FT                   RKKGERKFVIHTIRAIIYCDLNKKPKEEERRQKRITSTEDALVELNSKLNKRNLITKEA
FT                   CEKAVDNIFKGQPEMRRLFNVEIGLNQHDALVMSWSKDEAIIPELEKTDGIFVLLTNHD
FT                   KEKVDANELLTRYRSRNDIEISFRFLKGSLDLQQVFLRNPERVDAYCFLKVLAMLVINL
FT                   AAWLLARNYKKMSTQKLQKELGDLTISEQRLQPIGVRHWNGTNIPNSIDVLVNLFNLPH
FT                   PLELIEIINSSINFSYYIEKWFNDNLKK"
     MDLQPILEQL AKLPPEALMK IMPELKVEVP KANPSGAVLI GVFLARSLGI GKIIDDFIDE        60
     EYVTYEHLRE ERSNGSNCRV STGLACEIMI GDMLGRNKDL TRLYKFEEAC ENWQVETILG       120
     IPAKKFNDDK MGRALDTLNS NAKYMANVLQ DVVLSASKRF DIPLNTFYND TSSVPVYGDM       180
     ENNDKVQYGY GGMPGLKQLI LNLTISAGAS LPVTSTIDPG NVQGGNTFER SFEKVKEITD       240
     GQEFEMIIDR GILTQDNMHL MLTNSNKKAL FIGPLKDELS KNWVLEQLDN TEKDDFVSIE       300
     YRSKKEIERN LTKHYVAFET EYTFKVEIDP LSKDKKDKKR RKKGERKFVI HTIRAIIYCD       360
     LNKKPKEEER RQKRITSTED ALVELNSKLN KRNLITKEAC EKAVDNIFKG QPEMRRLFNV       420
     EIGLNQHDAL VMSWSKDEAI IPELEKTDGI FVLLTNHDKE KVDANELLTR YRSRNDIEIS       480
     FRFLKGSLDL QQVFLRNPER VDAYCFLKVL AMLVINLAAW LLARNYKKMS TQKLQKELGD       540
     LTISEQRLQP IGVRHWNGTN IPNSIDVLVN LFNLPHPLEL IEIINSSINF SYYIEKWFND       600
     NLKK                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page