(data stored in ACNUC7421 zone)

EMBL: CP001720.PE369

CP001720.PE369       Location/Qualifiers
FT   CDS             403562..404020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61334"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61334.1"
FT                   /translation="MKKKKMFIILGIMVLLLAGISNYSFGGSKYSPKEHEVQQQVIDTF
FT                   DLANDLKSNALRPQFMRDIYDDEIATESKEIRSKVALAILSLQKEKEFSEGDFKPMIFL
FT                   NKGNDKALIAVKHSDNTIILYKFDISKGDKPLKLDEQVKDVKVDRGDK"
     MKKKKMFIIL GIMVLLLAGI SNYSFGGSKY SPKEHEVQQQ VIDTFDLAND LKSNALRPQF        60
     MRDIYDDEIA TESKEIRSKV ALAILSLQKE KEFSEGDFKP MIFLNKGNDK ALIAVKHSDN       120
     TIILYKFDIS KGDKPLKLDE QVKDVKVDRG DK                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page