(data stored in ACNUC7421 zone)

EMBL: CP001720.PE371

CP001720.PE371       Location/Qualifiers
FT   CDS             complement(404714..404932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61336"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61336.1"
FT                   /translation="MAPTINSMALCYGLGGSNSEDLVAPPPRNIQTVPAFASQDHNFHP
FT                   GGYVCNCYSDHDVLSVETILNLLGIDL"
     MAPTINSMAL CYGLGGSNSE DLVAPPPRNI QTVPAFASQD HNFHPGGYVC NCYSDHDVLS        60
     VETILNLLGI DL                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page