(data stored in ACNUC7421 zone)

EMBL: CP001720.PE376

CP001720.PE376       Location/Qualifiers
FT   CDS             complement(408715..409185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61341"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61341.1"
FT                   /translation="MIKKVVFLIFGLMILFLGFTKISFGGDKYSEREYKVQKQVIDTFV
FT                   LDVNDSRDNESKDSKLKPLFMRDIYDDEIAQESHETRVKIAKAINILYKEKEIREGDFK
FT                   PMIFLKGNTNVLIAVKHPNNTISLTDFDISNKEPVEVDKQVKEMKDNKQQLD"
     MIKKVVFLIF GLMILFLGFT KISFGGDKYS EREYKVQKQV IDTFVLDVND SRDNESKDSK        60
     LKPLFMRDIY DDEIAQESHE TRVKIAKAIN ILYKEKEIRE GDFKPMIFLK GNTNVLIAVK       120
     HPNNTISLTD FDISNKEPVE VDKQVKEMKD NKQQLD                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page