(data stored in ACNUC7421 zone)

EMBL: CP001720.PE377

CP001720.PE377       Location/Qualifiers
FT   CDS             complement(409886..410614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0399"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-
FT                   binding region; SMART: response regulator receiver; KEGG:
FT                   aba:Acid345_3291 transcriptional regulator, LytR/AlgR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61342"
FT                   /db_xref="GOA:C8W4Z0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61342.1"
FT                   /translation="MLEARVLIVEDNEDVREHIKTIINTQADFTVVGECGNGNEVLDLV
FT                   EKYHPNIVLLDIEIPSRTGIDVAKDLAELKPGIFLIFITGHSEFCLTAFEIKSLDYILK
FT                   PFTEERVISSLLRAKSFLNCLNPAFVNMSRISIKTRGGTIIFIEAKSISYIEKVKGIKY
FT                   ISIYTDHGYYNITETLNDIEAKLPEQFYRCHKSFIINLERVKALVRDGLNTFHVLLNNS
FT                   KQKVSVSKYHYDELIKKLNS"
     MLEARVLIVE DNEDVREHIK TIINTQADFT VVGECGNGNE VLDLVEKYHP NIVLLDIEIP        60
     SRTGIDVAKD LAELKPGIFL IFITGHSEFC LTAFEIKSLD YILKPFTEER VISSLLRAKS       120
     FLNCLNPAFV NMSRISIKTR GGTIIFIEAK SISYIEKVKG IKYISIYTDH GYYNITETLN       180
     DIEAKLPEQF YRCHKSFIIN LERVKALVRD GLNTFHVLLN NSKQKVSVSK YHYDELIKKL       240
     NS                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page