(data stored in ACNUC7421 zone)

EMBL: CP001720.PE380

CP001720.PE380       Location/Qualifiers
FT   CDS             413494..413688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61345"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61345.1"
FT                   /translation="MRAINWNYFTGADPGKNLEGTFFLFTNFFEQSQEKQAEAPATDFS
FT                   ADEDCHIPDEDEEGYDLEH"
     MRAINWNYFT GADPGKNLEG TFFLFTNFFE QSQEKQAEAP ATDFSADEDC HIPDEDEEGY        60
     DLEH                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page