(data stored in ACNUC7421 zone)

EMBL: CP001720.PE382

CP001720.PE382       Location/Qualifiers
FT   CDS             complement(415116..417311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0404"
FT                   /product="NifH/frxC-family protein"
FT                   /note="PFAM: NifH/frxC-family protein;
FT                   oxidoreductase/nitrogenase component 1; KEGG: dal:Dalk_0725
FT                   NifH/FrxC-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61347"
FT                   /db_xref="GOA:C8W4Z5"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z5"
FT                   /inference="protein motif:PFAM:PF00142"
FT                   /protein_id="ACV61347.1"
FT                   /translation="MKRIAVYGKGGIGKSTISANLSAAFALAGHRVLQIGCDPKHDSTR
FT                   LLLQGKRLTTVLDYLRITNPLEYRLEDILEEGFAGIGCVEAGGPKPGVGCAGRGIISTF
FT                   ELLEKFKLHDRYGVTVYDVLGDVVCGGFAVPIRREYADTILIVTSGEFMALYAANNILR
FT                   GIRNYDGTERRVAGLVYNRRNVEGEDEHVARFAAAVGLPICATVPRSDAFSHAERANRT
FT                   VIEMEADAEVCAIFHRLAAALDGCTLYEAKPLTDEALEETVLGISLEQTPTEAANSGAE
FT                   PVEKLPPPAEIGLTDQNRYLSKNLIRGEPLHGCAFNGAVSTAVHLRDALVLAHAPKSCA
FT                   HISYQTIISSGRRKLFERGALLPASLMPNLECTEMGEPEIVFGGTEKLEERLLALKKQK
FT                   PRAIVVVSSCPAGIIGDDIDRVKNLSEPGLPVIPVRADGNMAGDYLQGMFMSYIALARS
FT                   IIKRNVPPVPDTVNIVAEKIVVTNTEDNFSVINGYLSQMGVRVNCRFLYNTTANALENF
FT                   CAAPLNLPAYGDYTANTLRGFFEKEYGARFFPLAFPVGLEETADWLRGVAAFFGRPDAA
FT                   AKIIAEHTERYMREIAALRPQLSGKKLMIITYNHELDWILKTALDAGMEIAKIGVLNYS
FT                   QDEGFRTRLSVSLPVEENYDRERRADDIAAYRPDVLLTNYASSVAEDVPVADTIPMCPN
FT                   VGFESGLTLARRWARLLQLNVKGAWRQDEQLFKQYYA"
     MKRIAVYGKG GIGKSTISAN LSAAFALAGH RVLQIGCDPK HDSTRLLLQG KRLTTVLDYL        60
     RITNPLEYRL EDILEEGFAG IGCVEAGGPK PGVGCAGRGI ISTFELLEKF KLHDRYGVTV       120
     YDVLGDVVCG GFAVPIRREY ADTILIVTSG EFMALYAANN ILRGIRNYDG TERRVAGLVY       180
     NRRNVEGEDE HVARFAAAVG LPICATVPRS DAFSHAERAN RTVIEMEADA EVCAIFHRLA       240
     AALDGCTLYE AKPLTDEALE ETVLGISLEQ TPTEAANSGA EPVEKLPPPA EIGLTDQNRY       300
     LSKNLIRGEP LHGCAFNGAV STAVHLRDAL VLAHAPKSCA HISYQTIISS GRRKLFERGA       360
     LLPASLMPNL ECTEMGEPEI VFGGTEKLEE RLLALKKQKP RAIVVVSSCP AGIIGDDIDR       420
     VKNLSEPGLP VIPVRADGNM AGDYLQGMFM SYIALARSII KRNVPPVPDT VNIVAEKIVV       480
     TNTEDNFSVI NGYLSQMGVR VNCRFLYNTT ANALENFCAA PLNLPAYGDY TANTLRGFFE       540
     KEYGARFFPL AFPVGLEETA DWLRGVAAFF GRPDAAAKII AEHTERYMRE IAALRPQLSG       600
     KKLMIITYNH ELDWILKTAL DAGMEIAKIG VLNYSQDEGF RTRLSVSLPV EENYDRERRA       660
     DDIAAYRPDV LLTNYASSVA EDVPVADTIP MCPNVGFESG LTLARRWARL LQLNVKGAWR       720
     QDEQLFKQYY A                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page