(data stored in ACNUC7421 zone)

EMBL: CP001720.PE383

CP001720.PE383       Location/Qualifiers
FT   CDS             complement(417458..418192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61348"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61348.1"
FT                   /translation="MEEWIQKHDSGLDLTTSMERLRDNPSVEGKLRFFAELKAARLLVP
FT                   CHGENGSIAALNTPEKEVFLPAFCSADELQKWTFPLEKVSVLPLDALKHIVIDNPAQLA
FT                   GVVINPFGKALLLRHPQLAEIDSGTEGMTLARTDHQGKLDIRATTDFPVGLPKALAQLL
FT                   ATRPEVYRAWILLAREEKETRYHKLFLIDFDGDRRLLFPLVAKAVQPYMKPGESFELMK
FT                   ADFGLLQRALAVSEPVYQKKKA"
     MEEWIQKHDS GLDLTTSMER LRDNPSVEGK LRFFAELKAA RLLVPCHGEN GSIAALNTPE        60
     KEVFLPAFCS ADELQKWTFP LEKVSVLPLD ALKHIVIDNP AQLAGVVINP FGKALLLRHP       120
     QLAEIDSGTE GMTLARTDHQ GKLDIRATTD FPVGLPKALA QLLATRPEVY RAWILLAREE       180
     KETRYHKLFL IDFDGDRRLL FPLVAKAVQP YMKPGESFEL MKADFGLLQR ALAVSEPVYQ       240
     KKKA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page