(data stored in ACNUC7421 zone)

EMBL: CP001720.PE384

CP001720.PE384       Location/Qualifiers
FT   CDS             423066..425318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0410"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Propeptide PepSY amd
FT                   peptidase M4; KEGG: bar:GBAA_pXO1_0124 S-layer protein,
FT                   (pXO1-90)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61349"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z7"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61349.1"
FT                   /translation="MRRKAFCFSAVLLFGSLLMSTAASAEQTASQIVIKQVTVTEAKKL
FT                   PPASEEKKDSPRISEDEALKIIKSAFPEIIGESKPDMQLDFEDYHGRNVWRINNYERMY
FT                   HGPGMPAGYDASLDADTGEILSMNRRNNTPTETRGIIQKQEAQKIAEQFIQKLQPERFK
FT                   NLQLQKSPTENYYPLPSLNMVYRFHWARVENGLKIDYDGINVSVDALSGEVASFDMNWR
FT                   PEVKLPAAGTPVPAKALIEKATNELGMALIYQVPYRNYTGKPPEANLIYQLNTRELMFN
FT                   AANGKAVDNQGREKDIKDIGMFEDIPKISGVNNPPDSPGQRITVEKARSTAERFFRSLG
FT                   IEGEVEMGGGGSSMGGPFGNQEFWSFEIVQKDSSRYYPGSQVGIDRATGRVVNYYERGP
FT                   ETQAETGSPKISQEEALAKADSFIKNVAPEYSPYLAPEKNQVDMYGIGNEQGYGFHFYR
FT                   VVNGIPFPLDGIHIGISSDGKIRDYHCEWHKVSFPAVQNTLAPGEAAGKWLELSPLQLT
FT                   YFIPREGEKPGRQAILVYRPDNDGFSAIDALTGKPVAYDGQPVNKTSGSGYDYKQSWAA
FT                   QYLEILAGSGILPSPEQFSPTGAVKKRDAARLIIAAMGNYYDYDEKREQQFLDINPEDP
FT                   DFKAIQAGAILGVYDEGGNFNPEQPFTRLTLARWMVNAMGYAEIAKINNNIASSYKDIA
FT                   SLSATDRNYIGLAQGLGIMRGDETGLFKPSDSVTWEELAAVAINSAPKMRNKSGMW"
     MRRKAFCFSA VLLFGSLLMS TAASAEQTAS QIVIKQVTVT EAKKLPPASE EKKDSPRISE        60
     DEALKIIKSA FPEIIGESKP DMQLDFEDYH GRNVWRINNY ERMYHGPGMP AGYDASLDAD       120
     TGEILSMNRR NNTPTETRGI IQKQEAQKIA EQFIQKLQPE RFKNLQLQKS PTENYYPLPS       180
     LNMVYRFHWA RVENGLKIDY DGINVSVDAL SGEVASFDMN WRPEVKLPAA GTPVPAKALI       240
     EKATNELGMA LIYQVPYRNY TGKPPEANLI YQLNTRELMF NAANGKAVDN QGREKDIKDI       300
     GMFEDIPKIS GVNNPPDSPG QRITVEKARS TAERFFRSLG IEGEVEMGGG GSSMGGPFGN       360
     QEFWSFEIVQ KDSSRYYPGS QVGIDRATGR VVNYYERGPE TQAETGSPKI SQEEALAKAD       420
     SFIKNVAPEY SPYLAPEKNQ VDMYGIGNEQ GYGFHFYRVV NGIPFPLDGI HIGISSDGKI       480
     RDYHCEWHKV SFPAVQNTLA PGEAAGKWLE LSPLQLTYFI PREGEKPGRQ AILVYRPDND       540
     GFSAIDALTG KPVAYDGQPV NKTSGSGYDY KQSWAAQYLE ILAGSGILPS PEQFSPTGAV       600
     KKRDAARLII AAMGNYYDYD EKREQQFLDI NPEDPDFKAI QAGAILGVYD EGGNFNPEQP       660
     FTRLTLARWM VNAMGYAEIA KINNNIASSY KDIASLSATD RNYIGLAQGL GIMRGDETGL       720
     FKPSDSVTWE ELAAVAINSA PKMRNKSGMW                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page