(data stored in ACNUC7421 zone)

EMBL: CP001720.PE386

CP001720.PE386       Location/Qualifiers
FT   CDS             426048..426494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0412"
FT                   /product="nucleic acid-binding protein contains PIN
FT                   domain-like protein"
FT                   /note="KEGG: sme:SMa0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61351"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z9"
FT                   /inference="protein motif:COG:COG4113"
FT                   /protein_id="ACV61351.1"
FT                   /translation="MSSFICLDSSVLIKLLVNEEDSNKAVVLMDRVINERLTVVLPDFA
FT                   WTEVGTVLRKKVFRKLISSEQAENAWEAFTNLGVLSFISDMAIMRSAWRIAEEEELPTL
FT                   YDAAYLAVAEIVSRQYNKTCEFWTADERLVNSVRDKDYVRFLSD"
     MSSFICLDSS VLIKLLVNEE DSNKAVVLMD RVINERLTVV LPDFAWTEVG TVLRKKVFRK        60
     LISSEQAENA WEAFTNLGVL SFISDMAIMR SAWRIAEEEE LPTLYDAAYL AVAEIVSRQY       120
     NKTCEFWTAD ERLVNSVRDK DYVRFLSD                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page