(data stored in ACNUC7421 zone)

EMBL: CP001720.PE388

CP001720.PE388       Location/Qualifiers
FT   CDS             428835..429113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0414"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: rfe:RF_0827
FT                   DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61353"
FT                   /db_xref="GOA:C8W501"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:C8W501"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACV61353.1"
FT                   /translation="MANTTSNVSFRIDSDLKAQADILFSQLGLNMTTAFNIFLRQAVRE
FT                   GCIPFDITINTPNAETITALLEAERIARDPSVKRYDDVEEALKELKS"
     MANTTSNVSF RIDSDLKAQA DILFSQLGLN MTTAFNIFLR QAVREGCIPF DITINTPNAE        60
     TITALLEAER IARDPSVKRY DDVEEALKEL KS                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page