(data stored in ACNUC7421 zone)

EMBL: CP001720.PE39

CP001720.PE39        Location/Qualifiers
FT   CDS             40101..41465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0040"
FT                   /product="germination protein YpeB"
FT                   /note="TIGRFAM: germination protein YpeB; PFAM: Propeptide
FT                   PepSY amd peptidase M4; KEGG: bha:BH1632 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61004"
FT                   /db_xref="GOA:C8VVD3"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD3"
FT                   /inference="protein motif:TFAM:TIGR02889"
FT                   /protein_id="ACV61004.1"
FT                   /translation="MKKRYFAIPVLIGFLAILGLGYWGFKEQQTRKMAEAYVNNNYQRS
FT                   FYNLADHVQNMEVLLSKSLLVSEKKYDGKVYSDIWQHASAAQENLTQLPVNQSIVGRTS
FT                   KFLTQVGDYSRMMAAGAGSDTEISSDKWKTLNKLYLQSQELNKDLQTAQSNLMNGHVSI
FT                   QELAGESGSKMQGQAKRLASSNFQQINQKVQDYPALIYDGPFSDHLEKTKPRGVTGASI
FT                   GVSEARSKALGYIEQSQKTNLVAQVTDKTKGKIPSYRTEIYPQKDNKNKTVVEVTQQGG
FT                   HLIWLINTRTVGKSTVSIDAAIKKAQQYLAKHGYKNMMNTYYVREDGSVTINFSYLDKN
FT                   DIIYYDDLIKVTVALDNGDIIAVDAAGYLMSHYDRKLAPPKVTLAEAKKAVNKNVNIKG
FT                   GRLAVIPTDSGGEKLTYEFSGVLNKEIYLIYIDSQTGKQEKILKVIGTNNGTLTM"
     MKKRYFAIPV LIGFLAILGL GYWGFKEQQT RKMAEAYVNN NYQRSFYNLA DHVQNMEVLL        60
     SKSLLVSEKK YDGKVYSDIW QHASAAQENL TQLPVNQSIV GRTSKFLTQV GDYSRMMAAG       120
     AGSDTEISSD KWKTLNKLYL QSQELNKDLQ TAQSNLMNGH VSIQELAGES GSKMQGQAKR       180
     LASSNFQQIN QKVQDYPALI YDGPFSDHLE KTKPRGVTGA SIGVSEARSK ALGYIEQSQK       240
     TNLVAQVTDK TKGKIPSYRT EIYPQKDNKN KTVVEVTQQG GHLIWLINTR TVGKSTVSID       300
     AAIKKAQQYL AKHGYKNMMN TYYVREDGSV TINFSYLDKN DIIYYDDLIK VTVALDNGDI       360
     IAVDAAGYLM SHYDRKLAPP KVTLAEAKKA VNKNVNIKGG RLAVIPTDSG GEKLTYEFSG       420
     VLNKEIYLIY IDSQTGKQEK ILKVIGTNNG TLTM                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page