(data stored in ACNUC7421 zone)

EMBL: CP001720.PE394

CP001720.PE394       Location/Qualifiers
FT   CDS             complement(433750..438939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0422"
FT                   /product="cell wall/surface repeat protein"
FT                   /note="TIGRFAM: cell wall/surface repeat protein; PFAM:
FT                   protein of unknown function DUF291; S-layer domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61359"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:C8W507"
FT                   /inference="protein motif:TFAM:TIGR02543"
FT                   /protein_id="ACV61359.1"
FT                   /translation="MKRNILRKALSLLLALVLLVPLASPAFAAEDIEESTLQSDAPMIL
FT                   GAGNGLAVWAGEKLAGGVVSSIAGYPMNQAMGKIFGTQTDQVLQALEAIKVQIQGLKND
FT                   IAEMSKKLDRQELRNFLNGYGDSINNYISVYNELSSAQKITDPAMLKILFEKIFKGEDP
FT                   NYMVGGNSLKNATINLGNQLRIVKAVEGGSCNIFGAIDLYDRYVNIWEHQGYVMREDFR
FT                   NKQLSIYTLFSAMSQLACQSIIDNNQGDTPSARLAKYQAESRMKDLKDDAELMDKMVKR
FT                   TSVVNPDNTISVYRHPNLRIARDIKQGIDLCAFSPDIKVAYVTKNAWGDEAAWADFSQS
FT                   AERYTSVDYLMSLTNDKTARRTAWSGGWEVYTNQPTPAEYQILRENYGGQQSLYNIFFD
FT                   ADKGNFNNVGNRPAELAFLCNHYVSRNCRDGWINWESNNHVGNNGEVYGWWKFSAARFI
FT                   SDTYAGSARDNWFDPSNAFIVNKYLGEVKQGSLQGPNSPPDIEYKATISGMDTEYEVGY
FT                   DSGITLEIDKTGDAYQWVVNKNDDKGFVELEGETGKTYSISDGLTSDMNGWQYSCTVID
FT                   NPAEPDGEPTYTHALPVTLNLTGDGISDPVTEHEVGDADALKTALDKVDSGEWNQHTLK
FT                   LADDITYPNPIAPDGMCSVTLDLNGYTLTVQPGANAESNVNAMSNNPQIAAICLNQDQL
FT                   TIEDSSIDGLGLLNIVAGPGIEYGIYAANDSGFDGYDAVTEEAVTVTSTVGGTAIYAAD
FT                   DSFVGVKGSVRAEGEDAYGIECLNSGSAVIVDKDVTVSGKSACGAYVASFDGGTSTQVV
FT                   RIFGDLTISGENSRAALLDAEAELTVRGSVTVTGGREGISVSNGYVETWGNVTAPDYAI
FT                   NARSNKASVVVLGNISVTRENAVAVSFVGAEIRVGGNVSSSNSGGVGILAATWMDPDDG
FT                   DVKCGASVTAEGKIVAVTPLLIESTPVTDESEKASTDLDYNVFTIPGKGTSAVKAMPGA
FT                   FEVKATSLVTFDKNGGDTEASPNTKAVITGGKAGILPTAPGRSGYTFNGWNTQVNGSGT
FT                   AFTANTDVTGPITVYAQWEYSVVNAAISPASASYDLNSPGDVSTAIIWNSASTITDVVY
FT                   GTTSLTTPAAYIVTESALTIKSSYLEEQGFSEGNTAEFMIDFDKGDSAKLTVNIVNNYI
FT                   LSDDAGLSDLKVGGSTVSGFDPNVFAYSVELPYDTLPGSQAATVSADVYNTKAVASITQ
FT                   AISLPGSAAVKVTAEDKTTTKTYTVNFTLEQAPTTYTITVQTDGNGTANANISSASQGT
FT                   QITLTANANNGYRFKEWQVIDGGVTITGNKFNMPASNVTVKVIFEYKSGGGSGGGGSSI
FT                   PTTPTIPAAGGTVSVNYTASNGTASLSLPMVKVNEIIEKSKSNEAVLDLSKVSGITAAS
FT                   IPKDVLATFAKAGLDTTVKLPVGTITLDEDATVSVAQQASGSNLAIELKQAATSSLTDE
FT                   QKKSVKSGDIVLDINITSGTKKISTFDGTLAVSMPYTGPQPVAVWYLNDGGELEKLDCT
FT                   FKNGVVSFNLDHLSLYVVGQDTAKPTWVNPFTDAKEADWFYAAVSFCAEKGITNGTSAT
FT                   TFSPNATLTREQFITMLLRAYGIEPIVNPSDNFSDAGSTYYTGYLAAAKDRGISNGVGD
FT                   NKFAPGKAITRQEMFTLLYNVIKFLNKLPTTDNGKTLADFTDSGDVATWARDAMIMLIK
FT                   SGTVSGSGGKLDPIGGSTRAQMAQVLYNLLGK"
     MKRNILRKAL SLLLALVLLV PLASPAFAAE DIEESTLQSD APMILGAGNG LAVWAGEKLA        60
     GGVVSSIAGY PMNQAMGKIF GTQTDQVLQA LEAIKVQIQG LKNDIAEMSK KLDRQELRNF       120
     LNGYGDSINN YISVYNELSS AQKITDPAML KILFEKIFKG EDPNYMVGGN SLKNATINLG       180
     NQLRIVKAVE GGSCNIFGAI DLYDRYVNIW EHQGYVMRED FRNKQLSIYT LFSAMSQLAC       240
     QSIIDNNQGD TPSARLAKYQ AESRMKDLKD DAELMDKMVK RTSVVNPDNT ISVYRHPNLR       300
     IARDIKQGID LCAFSPDIKV AYVTKNAWGD EAAWADFSQS AERYTSVDYL MSLTNDKTAR       360
     RTAWSGGWEV YTNQPTPAEY QILRENYGGQ QSLYNIFFDA DKGNFNNVGN RPAELAFLCN       420
     HYVSRNCRDG WINWESNNHV GNNGEVYGWW KFSAARFISD TYAGSARDNW FDPSNAFIVN       480
     KYLGEVKQGS LQGPNSPPDI EYKATISGMD TEYEVGYDSG ITLEIDKTGD AYQWVVNKND       540
     DKGFVELEGE TGKTYSISDG LTSDMNGWQY SCTVIDNPAE PDGEPTYTHA LPVTLNLTGD       600
     GISDPVTEHE VGDADALKTA LDKVDSGEWN QHTLKLADDI TYPNPIAPDG MCSVTLDLNG       660
     YTLTVQPGAN AESNVNAMSN NPQIAAICLN QDQLTIEDSS IDGLGLLNIV AGPGIEYGIY       720
     AANDSGFDGY DAVTEEAVTV TSTVGGTAIY AADDSFVGVK GSVRAEGEDA YGIECLNSGS       780
     AVIVDKDVTV SGKSACGAYV ASFDGGTSTQ VVRIFGDLTI SGENSRAALL DAEAELTVRG       840
     SVTVTGGREG ISVSNGYVET WGNVTAPDYA INARSNKASV VVLGNISVTR ENAVAVSFVG       900
     AEIRVGGNVS SSNSGGVGIL AATWMDPDDG DVKCGASVTA EGKIVAVTPL LIESTPVTDE       960
     SEKASTDLDY NVFTIPGKGT SAVKAMPGAF EVKATSLVTF DKNGGDTEAS PNTKAVITGG      1020
     KAGILPTAPG RSGYTFNGWN TQVNGSGTAF TANTDVTGPI TVYAQWEYSV VNAAISPASA      1080
     SYDLNSPGDV STAIIWNSAS TITDVVYGTT SLTTPAAYIV TESALTIKSS YLEEQGFSEG      1140
     NTAEFMIDFD KGDSAKLTVN IVNNYILSDD AGLSDLKVGG STVSGFDPNV FAYSVELPYD      1200
     TLPGSQAATV SADVYNTKAV ASITQAISLP GSAAVKVTAE DKTTTKTYTV NFTLEQAPTT      1260
     YTITVQTDGN GTANANISSA SQGTQITLTA NANNGYRFKE WQVIDGGVTI TGNKFNMPAS      1320
     NVTVKVIFEY KSGGGSGGGG SSIPTTPTIP AAGGTVSVNY TASNGTASLS LPMVKVNEII      1380
     EKSKSNEAVL DLSKVSGITA ASIPKDVLAT FAKAGLDTTV KLPVGTITLD EDATVSVAQQ      1440
     ASGSNLAIEL KQAATSSLTD EQKKSVKSGD IVLDINITSG TKKISTFDGT LAVSMPYTGP      1500
     QPVAVWYLND GGELEKLDCT FKNGVVSFNL DHLSLYVVGQ DTAKPTWVNP FTDAKEADWF      1560
     YAAVSFCAEK GITNGTSATT FSPNATLTRE QFITMLLRAY GIEPIVNPSD NFSDAGSTYY      1620
     TGYLAAAKDR GISNGVGDNK FAPGKAITRQ EMFTLLYNVI KFLNKLPTTD NGKTLADFTD      1680
     SGDVATWARD AMIMLIKSGT VSGSGGKLDP IGGSTRAQMA QVLYNLLGK                  1729
//

If you have problems or comments...

PBIL Back to PBIL home page