(data stored in ACNUC7421 zone)

EMBL: CP001720.PE395

CP001720.PE395       Location/Qualifiers
FT   CDS             complement(439141..440076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0423"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain-containing protein
FT                   AraC type; SMART: helix-turn-helix- domain-containing
FT                   protein AraC type; KEGG: scl:sce7020 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61360"
FT                   /db_xref="GOA:C8W508"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8W508"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACV61360.1"
FT                   /translation="MKYITVNEAAEKWGLSRRSISHHLTAGRIPGAVKKGGFWLIPKDV
FT                   AKPKDKRYKKSTGKTEESFGSPPSLTENKDLFVEMFKHFPYPVQICDPEGAMLFANAAF
FT                   FRHIKLSDPPEDLRIFNTRYEPNLEKWGIKDFVERAYRGEVAHIYDVKMPIREAVSKYG
FT                   GNAELPSESIFVNMTSFPIYDENHQIAYVVGIFIPSRYYQGREEVIQGKEYMDDHWKED
FT                   FDADALSSIVHISKPHYTRLFKQHTGTTPHQYYQGVKLQKLKEMLCDNNLSIAQVFDEC
FT                   GVNYNGNLAKKLKQELGMTPSEYRARMMQK"
     MKYITVNEAA EKWGLSRRSI SHHLTAGRIP GAVKKGGFWL IPKDVAKPKD KRYKKSTGKT        60
     EESFGSPPSL TENKDLFVEM FKHFPYPVQI CDPEGAMLFA NAAFFRHIKL SDPPEDLRIF       120
     NTRYEPNLEK WGIKDFVERA YRGEVAHIYD VKMPIREAVS KYGGNAELPS ESIFVNMTSF       180
     PIYDENHQIA YVVGIFIPSR YYQGREEVIQ GKEYMDDHWK EDFDADALSS IVHISKPHYT       240
     RLFKQHTGTT PHQYYQGVKL QKLKEMLCDN NLSIAQVFDE CGVNYNGNLA KKLKQELGMT       300
     PSEYRARMMQ K                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page