(data stored in ACNUC7421 zone)

EMBL: CP001720.PE401

CP001720.PE401       Location/Qualifiers
FT   CDS             complement(446380..447792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0435"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: gsu:GSU2670 LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61366"
FT                   /db_xref="GOA:C8W514"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W514"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV61366.1"
FT                   /translation="MLKLGGWAGDSISLTLLFTWILSYPMHGFFLQGVAGPNFYVLGHL
FT                   FTASHGLGLFTIGSLSITMLQNKTFIKLAGVSVLVLTIAYTILPQSGSIKYIICIILGF
FT                   SSAYLVLAWACVFTGSNIAPELTLGVAMALTNVLLGLIGFAHNIPKTAFITASALSGLA
FT                   PLISAFYITRKQPSVKLQNVQNEQKDIKAGLTTFLGIAFLVAAAFFSGGLWYRAVLPLF
FT                   HLKWPDIMGIGSFIYAAAVLGLSLNAQKHSLYWLGTISLSALGIGLATSLIGLDKSVVL
FT                   ALTLIILAAGLGALDLFFWLTLRKLSLFLGTQRSFGFGLGLSLFFITAPGIAIDTGVLT
FT                   NPLESPVMSVIGACLLFLINPLLVQLLQHLSVSLPKHDGVYDSFHEPTATNKGEENQTV
FT                   THYPEFWYNFTASEKRVYEFICKGWTDPEIAAHLNISRHTVKFHVRNLLRKAGVSNRKE
FT                   LLAQLVSNRDEK"
     MLKLGGWAGD SISLTLLFTW ILSYPMHGFF LQGVAGPNFY VLGHLFTASH GLGLFTIGSL        60
     SITMLQNKTF IKLAGVSVLV LTIAYTILPQ SGSIKYIICI ILGFSSAYLV LAWACVFTGS       120
     NIAPELTLGV AMALTNVLLG LIGFAHNIPK TAFITASALS GLAPLISAFY ITRKQPSVKL       180
     QNVQNEQKDI KAGLTTFLGI AFLVAAAFFS GGLWYRAVLP LFHLKWPDIM GIGSFIYAAA       240
     VLGLSLNAQK HSLYWLGTIS LSALGIGLAT SLIGLDKSVV LALTLIILAA GLGALDLFFW       300
     LTLRKLSLFL GTQRSFGFGL GLSLFFITAP GIAIDTGVLT NPLESPVMSV IGACLLFLIN       360
     PLLVQLLQHL SVSLPKHDGV YDSFHEPTAT NKGEENQTVT HYPEFWYNFT ASEKRVYEFI       420
     CKGWTDPEIA AHLNISRHTV KFHVRNLLRK AGVSNRKELL AQLVSNRDEK                  470
//

If you have problems or comments...

PBIL Back to PBIL home page