(data stored in ACNUC7421 zone)

EMBL: CP001720.PE402

CP001720.PE402       Location/Qualifiers
FT   CDS             448277..451957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0436"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Ig domain protein
FT                   group 2 domain protein; SMART: Ig domain protein group 2
FT                   domain protein; KEGG: baa:BA_1469 SLH, S-layer homology
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61367"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C8W515"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61367.1"
FT                   /translation="MHNNRLFIVVLIIYMLLIFTGYAVAAEFSDISGHWAQGQINKWAE
FT                   KGLVSGYQDGTFKPNNQISRAEFVAMINRAFAIDKGNTTADFTDVKPGKWYYEEVISAK
FT                   TAGYIGGYVDGTFKPDQTITRQEVASILVRLLKINPSIEGLAKFGDAGQIQEWARGSVG
FT                   AAAKAGLMRGMPDNTFKPIRSITRAEAVVSLHNALAYASGEPKTVEEPKTVVGTTLEGT
FT                   VTLDGSALDKVVVRIFAADSHKVLKEVQTDNQGYFKAELKAGYYDITATTDSAVAYKAD
FT                   VNIVENKIAEINLNLEDAAIVKGILKDNNGRAVKNATILFTTNPTFITSTNINGEYTIA
FT                   VMADRTYTVRAYEQIHNDKEPSVVTSSQHVGSAGTQNIGTLKAPFTLAYTGGSSGGGSS
FT                   SNTQIISINTIDNLSIINGSTGQKTITTSPTDVTIKAFSSSEQVAGVTVLSKTMTISAN
FT                   EAGNATITVTAEKSGYESTTRTFTVNVIEKDKSIPLDNPVIIPEDAKKLEFTNGVQLDF
FT                   SVITIPAENTLTVTELSDSDYEVPSVQEGQVFKTAGKVVKIELQGNVDLNKGVNLVLPF
FT                   EGDPGADLAIFYFDNGEWKYMDSIVDVSNKVIQTTVYHFSNWAPFKASQVAKPEASTAS
FT                   GEIEKGTNVSLTTTSEGATIYYTTDGTVPTIRSSKYTGPIGINSNLTIKAIAVKSNMRN
FT                   SDEATFEYTVTEVPVTGIDVSLVKMDLTVEKTLEIDATVIPENATNKNVAWTSSNEEVA
FT                   TVSSSGLVTGVGVGVATITATTKDGGFAATCEVTVTAASPQTPVELEIICSSEREIWVS
FT                   VWNVSGNEHEPLLKLDRENFLLSDANGNEVEFKFNDPEVRDPDIPEHEYLLSPTEGEFT
FT                   GTNKLTFTKAGYQSGSKLFTIVSGDEGPFTPGEGGILPAFDPFTPQQNTIGCLYSVKSQ
FT                   RENRWLGGTEPVVELRFSPASQNDAESYTLQYSTNGTNWQNYQVYSEDLKSSATQDNFS
FT                   LSNPGGSYYYRLLVNGGPKNGYTSNAVAAPLSNINTYFSGWSLDESVYISGTMAPWIGR
FT                   GLEAAFTVKSLEEQSVVDEVYLSCQWYRVNPATYEMELIDGATSLTYITNESDAGYKLL
FT                   IQATGDGINIGGFEQVMSGFKNVLPNKAFASDVTDSGFTLNLYKSVDNLTSDVLILRNS
FT                   NDDLVPIISVTPVGSSKAKFTINADIPATNGPYRLENKSDFWLLMEEKEQGYMHEGLTI
FT                   E"
     MHNNRLFIVV LIIYMLLIFT GYAVAAEFSD ISGHWAQGQI NKWAEKGLVS GYQDGTFKPN        60
     NQISRAEFVA MINRAFAIDK GNTTADFTDV KPGKWYYEEV ISAKTAGYIG GYVDGTFKPD       120
     QTITRQEVAS ILVRLLKINP SIEGLAKFGD AGQIQEWARG SVGAAAKAGL MRGMPDNTFK       180
     PIRSITRAEA VVSLHNALAY ASGEPKTVEE PKTVVGTTLE GTVTLDGSAL DKVVVRIFAA       240
     DSHKVLKEVQ TDNQGYFKAE LKAGYYDITA TTDSAVAYKA DVNIVENKIA EINLNLEDAA       300
     IVKGILKDNN GRAVKNATIL FTTNPTFITS TNINGEYTIA VMADRTYTVR AYEQIHNDKE       360
     PSVVTSSQHV GSAGTQNIGT LKAPFTLAYT GGSSGGGSSS NTQIISINTI DNLSIINGST       420
     GQKTITTSPT DVTIKAFSSS EQVAGVTVLS KTMTISANEA GNATITVTAE KSGYESTTRT       480
     FTVNVIEKDK SIPLDNPVII PEDAKKLEFT NGVQLDFSVI TIPAENTLTV TELSDSDYEV       540
     PSVQEGQVFK TAGKVVKIEL QGNVDLNKGV NLVLPFEGDP GADLAIFYFD NGEWKYMDSI       600
     VDVSNKVIQT TVYHFSNWAP FKASQVAKPE ASTASGEIEK GTNVSLTTTS EGATIYYTTD       660
     GTVPTIRSSK YTGPIGINSN LTIKAIAVKS NMRNSDEATF EYTVTEVPVT GIDVSLVKMD       720
     LTVEKTLEID ATVIPENATN KNVAWTSSNE EVATVSSSGL VTGVGVGVAT ITATTKDGGF       780
     AATCEVTVTA ASPQTPVELE IICSSEREIW VSVWNVSGNE HEPLLKLDRE NFLLSDANGN       840
     EVEFKFNDPE VRDPDIPEHE YLLSPTEGEF TGTNKLTFTK AGYQSGSKLF TIVSGDEGPF       900
     TPGEGGILPA FDPFTPQQNT IGCLYSVKSQ RENRWLGGTE PVVELRFSPA SQNDAESYTL       960
     QYSTNGTNWQ NYQVYSEDLK SSATQDNFSL SNPGGSYYYR LLVNGGPKNG YTSNAVAAPL      1020
     SNINTYFSGW SLDESVYISG TMAPWIGRGL EAAFTVKSLE EQSVVDEVYL SCQWYRVNPA      1080
     TYEMELIDGA TSLTYITNES DAGYKLLIQA TGDGINIGGF EQVMSGFKNV LPNKAFASDV      1140
     TDSGFTLNLY KSVDNLTSDV LILRNSNDDL VPIISVTPVG SSKAKFTINA DIPATNGPYR      1200
     LENKSDFWLL MEEKEQGYMH EGLTIE                                           1226
//

If you have problems or comments...

PBIL Back to PBIL home page