(data stored in ACNUC7421 zone)

EMBL: CP001720.PE405

CP001720.PE405       Location/Qualifiers
FT   CDS             453733..455799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0439"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /EC_number="6.2.1.22"
FT                   /note="KEGG: vha:VIBHAR_05301 citrate lyase ligase;
FT                   TIGRFAM: cytidyltransferase-related domain protein; PFAM:
FT                   Citrate lyase ligase domain protein; SMART: Citrate lyase
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61370"
FT                   /db_xref="GOA:C8W518"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W518"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACV61370.1"
FT                   /translation="MNHFYYYELCEILSFVAAGKLAVLNSIEEESENYIQFFRKNHIDV
FT                   INNENNQIQEKDLFFIYTIYSENGVNKIIDSGCEFILPIMEYSGQLPMQSLKERVAKLQ
FT                   GHFQNRTGKLILLSDQKTCDLFEELNFIPDFFINTSGFIESNTERVNPKPGVPRNAFFL
FT                   IYTSVELGQLFEKLKYYQAFYFANDEKVHLPTVYLINKIGKLKRDKNVKVYYFNPPVLA
FT                   AVKHPSENEKMIMDAFSKCTLYEFIGMLIEGKFHDSLVNHKLEYFTKDYMKEILHIPRL
FT                   IQINQLKSLEDYESQYVNIKGGKRFTTDAPDQYKNIIHCFGSSQTYSFGVEDKYTFSSC
FT                   LQRRVNKNYPDTYLVLNYGVVGYFACHMLKAMDNAQINEGDIIIFYTAIDSEYFFDFAV
FT                   AADITTYNFQPMFQRPHNMGDVFIDTTHINHYGLEKLTEKAFKVMFTYKDILNDFSEIR
FT                   TSKLNEPLNQITSNPEFANYLSYLAEEKIVDFNQKKIGSVVMNCNPFTLGHQYLIQFAS
FT                   ESVDYLYIFLVEEDRSVFSFEDRYNMVKAGISKFDNVKLLRSGNFIISSITFPEYFTKE
FT                   TNKDVIIDPSLDLDIFGNCIAKALNISVRFAGEEPFDPITKQYNRFMENLLKKYDIKFV
FT                   EIKRKEYLDSPISASRVRKLLKEGNLEEMKKIVPKTTYDYLLNCWKGLDSCHR"
     MNHFYYYELC EILSFVAAGK LAVLNSIEEE SENYIQFFRK NHIDVINNEN NQIQEKDLFF        60
     IYTIYSENGV NKIIDSGCEF ILPIMEYSGQ LPMQSLKERV AKLQGHFQNR TGKLILLSDQ       120
     KTCDLFEELN FIPDFFINTS GFIESNTERV NPKPGVPRNA FFLIYTSVEL GQLFEKLKYY       180
     QAFYFANDEK VHLPTVYLIN KIGKLKRDKN VKVYYFNPPV LAAVKHPSEN EKMIMDAFSK       240
     CTLYEFIGML IEGKFHDSLV NHKLEYFTKD YMKEILHIPR LIQINQLKSL EDYESQYVNI       300
     KGGKRFTTDA PDQYKNIIHC FGSSQTYSFG VEDKYTFSSC LQRRVNKNYP DTYLVLNYGV       360
     VGYFACHMLK AMDNAQINEG DIIIFYTAID SEYFFDFAVA ADITTYNFQP MFQRPHNMGD       420
     VFIDTTHINH YGLEKLTEKA FKVMFTYKDI LNDFSEIRTS KLNEPLNQIT SNPEFANYLS       480
     YLAEEKIVDF NQKKIGSVVM NCNPFTLGHQ YLIQFASESV DYLYIFLVEE DRSVFSFEDR       540
     YNMVKAGISK FDNVKLLRSG NFIISSITFP EYFTKETNKD VIIDPSLDLD IFGNCIAKAL       600
     NISVRFAGEE PFDPITKQYN RFMENLLKKY DIKFVEIKRK EYLDSPISAS RVRKLLKEGN       660
     LEEMKKIVPK TTYDYLLNCW KGLDSCHR                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page