(data stored in ACNUC7421 zone)

EMBL: CP001720.PE406

CP001720.PE406       Location/Qualifiers
FT   CDS             455970..456515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0440"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bar:GBAA1753 RNA polymerase factor
FT                   sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61371"
FT                   /db_xref="GOA:C8W519"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W519"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACV61371.1"
FT                   /translation="MNFSESELISEIKKRNLNAYESLIKEYTKPVYYLTYNILNIGNSK
FT                   EDIEECVADVFLEVWLKINGFDSERSNFKTWVLIITKYKALTYKRKLKKNHVENIDDYQ
FT                   LEESDTVERQIIDRETQKKLLEIINSFNKTDKELFIRRYFYNEKISDIMQSLGLSRSAL
FT                   DNRLLRGRKIIKEVLSYD"
     MNFSESELIS EIKKRNLNAY ESLIKEYTKP VYYLTYNILN IGNSKEDIEE CVADVFLEVW        60
     LKINGFDSER SNFKTWVLII TKYKALTYKR KLKKNHVENI DDYQLEESDT VERQIIDRET       120
     QKKLLEIINS FNKTDKELFI RRYFYNEKIS DIMQSLGLSR SALDNRLLRG RKIIKEVLSY       180
     D                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page