(data stored in ACNUC7421 zone)

EMBL: CP001720.PE407

CP001720.PE407       Location/Qualifiers
FT   CDS             456508..457824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61372"
FT                   /db_xref="GOA:C8W520"
FT                   /db_xref="UniProtKB/TrEMBL:C8W520"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61372.1"
FT                   /translation="MTEKQIQTLMQNLDNDLLAKELDDLTNGLEIDLDSITKKAFTKLN
FT                   KRRLKMKRKRIYPLVAASLIAVIGISNAYAAEISDFVGSFFNQRAIYSTVVDGSAYYLE
FT                   SPLQLDKESKLENVIFTKDKLEMSLTLTLTEDKPPEISVATANGKIYKPGGYGYDNNRL
FT                   QLSFWNEAGHNYVFSPTKELKLNIGEKSYSIHLAEGAPVVGSGEIKPAEQTDIGWINVG
FT                   YKKIDQGVQILTSFTDKDLKLVGIGEPVQKTVTRMFKNEKGIITSGTSSMTKPLLGYDK
FT                   DKNIYTYNRAKNAVGRPVIQFESQAPADKEIELKIPGLLVGYEKDFGNFDVAIPGLNEE
FT                   KRIDREIDLKLQKIILQSIKRTSATTAELKFALNTGDTAKVAVQEVSLYSKDVQSGDSV
FT                   WQGDICTMRISFAEKLKNAEFNVSWPRFVVNGDWTLRIK"
     MTEKQIQTLM QNLDNDLLAK ELDDLTNGLE IDLDSITKKA FTKLNKRRLK MKRKRIYPLV        60
     AASLIAVIGI SNAYAAEISD FVGSFFNQRA IYSTVVDGSA YYLESPLQLD KESKLENVIF       120
     TKDKLEMSLT LTLTEDKPPE ISVATANGKI YKPGGYGYDN NRLQLSFWNE AGHNYVFSPT       180
     KELKLNIGEK SYSIHLAEGA PVVGSGEIKP AEQTDIGWIN VGYKKIDQGV QILTSFTDKD       240
     LKLVGIGEPV QKTVTRMFKN EKGIITSGTS SMTKPLLGYD KDKNIYTYNR AKNAVGRPVI       300
     QFESQAPADK EIELKIPGLL VGYEKDFGNF DVAIPGLNEE KRIDREIDLK LQKIILQSIK       360
     RTSATTAELK FALNTGDTAK VAVQEVSLYS KDVQSGDSVW QGDICTMRIS FAEKLKNAEF       420
     NVSWPRFVVN GDWTLRIK                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page