(data stored in ACNUC7421 zone)

EMBL: CP001720.PE408

CP001720.PE408       Location/Qualifiers
FT   CDS             complement(458003..458779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0442"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   scl:sce6748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61373"
FT                   /db_xref="GOA:C8W521"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W521"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ACV61373.1"
FT                   /translation="MGLYLKFFSMHLKSQMQYKVSFFLTAAGQFLVSFTSLLGVYFMFT
FT                   RFNEVEGFIFQQVLLCFATSLMAFSLAECFGRGFDVFPLMIGNGEFDRVLVRPRQEIFQ
FT                   VLSSKIELTRIGRLLQSIIVFCYAIPASGVIWTWDKILTLFLMIFCGSIIFFCLFLIYA
FT                   SFSFFTIEGLEFMNIFTDGGKEFGRYPFSIYGKKVLNFFTFIVPLALFQYYPLLYLLDM
FT                   KTSVSYMLTPLLGLLFIIPSYSFWRFGLRRYKSTGS"
     MGLYLKFFSM HLKSQMQYKV SFFLTAAGQF LVSFTSLLGV YFMFTRFNEV EGFIFQQVLL        60
     CFATSLMAFS LAECFGRGFD VFPLMIGNGE FDRVLVRPRQ EIFQVLSSKI ELTRIGRLLQ       120
     SIIVFCYAIP ASGVIWTWDK ILTLFLMIFC GSIIFFCLFL IYASFSFFTI EGLEFMNIFT       180
     DGGKEFGRYP FSIYGKKVLN FFTFIVPLAL FQYYPLLYLL DMKTSVSYML TPLLGLLFII       240
     PSYSFWRFGL RRYKSTGS                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page