(data stored in ACNUC7421 zone)

EMBL: CP001720.PE409

CP001720.PE409       Location/Qualifiers
FT   CDS             complement(458781..459584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0443"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="KEGG: aav:Aave_2072 putative ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61374"
FT                   /db_xref="GOA:C8W522"
FT                   /db_xref="UniProtKB/TrEMBL:C8W522"
FT                   /inference="similar to AA sequence:KEGG:Aave_2072"
FT                   /protein_id="ACV61374.1"
FT                   /translation="MKKYIAIIRIRFINSLQYRAAAIAGMATQFAWGLMEILAFSAFYR
FT                   ANPAAFPMEFSQTVSYIWMQQALLALFMVWFFEGEIFASITSGGIAYELARPVDLYSRW
FT                   FCQSMANRLAKAVLRCFPILIVAFIVPEPFRMSLPVNAGQFILFLVSASLSLFVVVSFS
FT                   MLIYISTFYTLSPMGVRLISAVLADFMAGATIPLPFFPPAFLTVAELMPFAAMQNMPLR
FT                   IYSGNIAGTDAALGIGLQLFWLLVLVLIGRLLMKNALKRVVVQGG"
     MKKYIAIIRI RFINSLQYRA AAIAGMATQF AWGLMEILAF SAFYRANPAA FPMEFSQTVS        60
     YIWMQQALLA LFMVWFFEGE IFASITSGGI AYELARPVDL YSRWFCQSMA NRLAKAVLRC       120
     FPILIVAFIV PEPFRMSLPV NAGQFILFLV SASLSLFVVV SFSMLIYIST FYTLSPMGVR       180
     LISAVLADFM AGATIPLPFF PPAFLTVAEL MPFAAMQNMP LRIYSGNIAG TDAALGIGLQ       240
     LFWLLVLVLI GRLLMKNALK RVVVQGG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page