(data stored in ACNUC7421 zone)

EMBL: CP001720.PE410

CP001720.PE410       Location/Qualifiers
FT   CDS             complement(459581..460555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0444"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce6750 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61375"
FT                   /db_xref="GOA:C8W523"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W523"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61375.1"
FT                   /translation="MIILKNINKTFRIAKRKSGFGQAFKALFSREYETVHALSDVSFTI
FT                   NDGEMIGYIGPNGAGKSTTLKIMCGVLTPDNGSCKIDGRTPWQDRIEHTKNIGVVFGQR
FT                   SQLWWDVPVCDSFELIRDIYKVNKTEYRHNLDELVELLDLSELLKTPTRSLSLGQRMRC
FT                   ELAASLLHSPQTLFLDEPTIGLDAVSKIAVRQFIKKLNTERGTTVILTTHDMQDIEALT
FT                   ERILLIGKGRILLDGSLLELKKHFSTRKTVVFEYNGEVSKLCDGMTVTEQKEGRLIIEL
FT                   DPLICSVSTAIAHLSSQVEVLDISVSGISAEEMVAVLYKEYRI"
     MIILKNINKT FRIAKRKSGF GQAFKALFSR EYETVHALSD VSFTINDGEM IGYIGPNGAG        60
     KSTTLKIMCG VLTPDNGSCK IDGRTPWQDR IEHTKNIGVV FGQRSQLWWD VPVCDSFELI       120
     RDIYKVNKTE YRHNLDELVE LLDLSELLKT PTRSLSLGQR MRCELAASLL HSPQTLFLDE       180
     PTIGLDAVSK IAVRQFIKKL NTERGTTVIL TTHDMQDIEA LTERILLIGK GRILLDGSLL       240
     ELKKHFSTRK TVVFEYNGEV SKLCDGMTVT EQKEGRLIIE LDPLICSVST AIAHLSSQVE       300
     VLDISVSGIS AEEMVAVLYK EYRI                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page