(data stored in ACNUC7421 zone)

EMBL: CP001720.PE411

CP001720.PE411       Location/Qualifiers
FT   CDS             460841..461854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0445"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: afw:Anae109_0117 cell shape determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61376"
FT                   /db_xref="GOA:C8W524"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C8W524"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACV61376.1"
FT                   /translation="MSIGIFSKDIGIDLGNANLLVYVKDEGIVLNEPSVVVIEKNANKI
FT                   LAAGYNAKMMIGRTPKNIVAIRPLKGGVINDFNATQAMIKLFIKKALPKFSMFKPRVVV
FT                   SVPMGVTTVEGQAVRQAVLQAGVREAYLVEEPMAAAIGSGLPVHEPIGNMIIDIGSGIT
FT                   EVAVISMGGIVTSNSIRIAGDDMDEAIIHHIKKEHNLLIGERTAEQIKINIGIAYPLED
FT                   TKAIKIKGRDLQTGLPREENITSKEIYQALSEPLASISAAIISTLEQTPPDFSVDIINN
FT                   GIVLVGGGAMLRGIDHLIHMQTGISVYVVNQPLLAVANGSGKILENINVLRKTLLN"
     MSIGIFSKDI GIDLGNANLL VYVKDEGIVL NEPSVVVIEK NANKILAAGY NAKMMIGRTP        60
     KNIVAIRPLK GGVINDFNAT QAMIKLFIKK ALPKFSMFKP RVVVSVPMGV TTVEGQAVRQ       120
     AVLQAGVREA YLVEEPMAAA IGSGLPVHEP IGNMIIDIGS GITEVAVISM GGIVTSNSIR       180
     IAGDDMDEAI IHHIKKEHNL LIGERTAEQI KINIGIAYPL EDTKAIKIKG RDLQTGLPRE       240
     ENITSKEIYQ ALSEPLASIS AAIISTLEQT PPDFSVDIIN NGIVLVGGGA MLRGIDHLIH       300
     MQTGISVYVV NQPLLAVANG SGKILENINV LRKTLLN                                337
//

If you have problems or comments...

PBIL Back to PBIL home page