(data stored in ACNUC7421 zone)

EMBL: CP001720.PE412

CP001720.PE412       Location/Qualifiers
FT   CDS             complement(462393..463187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0446"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vvu:VV1_0837 ABC-type oligopeptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61377"
FT                   /db_xref="GOA:C8W525"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W525"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61377.1"
FT                   /translation="MLIEVKNLVKEYTGGLFYKRTVKAVNGVSFSIKQGETLGLVGESG
FT                   CGKSTVARLLLMLIRPTSASIRFENTELTVKSPAELQKLRKEMQIIFQHPQQSLYPRRK
FT                   IYEAMAEPLRIHKLIKRKEEEKEKILQLLNDVGLLKEHLERYPHELSGGQAQRVAIARV
FT                   LALKPKFIVADEPTSMLDISVQAQILELMKKLQREHNIGMLFISHDLEVARAVSNRIAV
FT                   MHQGRLVEIGDSEQVFMKPQHPYTKYLTDTTLKLEEKQRFMG"
     MLIEVKNLVK EYTGGLFYKR TVKAVNGVSF SIKQGETLGL VGESGCGKST VARLLLMLIR        60
     PTSASIRFEN TELTVKSPAE LQKLRKEMQI IFQHPQQSLY PRRKIYEAMA EPLRIHKLIK       120
     RKEEEKEKIL QLLNDVGLLK EHLERYPHEL SGGQAQRVAI ARVLALKPKF IVADEPTSML       180
     DISVQAQILE LMKKLQREHN IGMLFISHDL EVARAVSNRI AVMHQGRLVE IGDSEQVFMK       240
     PQHPYTKYLT DTTLKLEEKQ RFMG                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page