(data stored in ACNUC7421 zone)

EMBL: CP001720.PE413

CP001720.PE413       Location/Qualifiers
FT   CDS             complement(463171..464178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0447"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61378"
FT                   /db_xref="GOA:C8W526"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W526"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61378.1"
FT                   /translation="MTDFLAFSDTDSFRHKHAVTEPLLSIVDLKAFFKIKDTVLKALDN
FT                   VSININHHEVVALVGETGCGKSVLVLSILGLLPKNACTEGSIRYLGKEILGIDEEELRG
FT                   LRGKAIGMIPQNPATSLNPLMKIGIQVMEIIRLHKKCNKSAAKHETINLFSRLRLPDPT
FT                   TSICCYPHQLSGGMRQRVLISMGIACNPGLILVDEPTKGLDAVLRKRVVDLLKEQVSSS
FT                   TSSMLLITHDFSVAAALADRVAVMYAGEIVETGPVSQILNHSRHPYTKSLLNSLPGRGF
FT                   NSIPGFSPSLTNLPPGCKFQPRCKTSSSRCAAHHPDMEEILTNHFVRCFHAHRS"
     MTDFLAFSDT DSFRHKHAVT EPLLSIVDLK AFFKIKDTVL KALDNVSINI NHHEVVALVG        60
     ETGCGKSVLV LSILGLLPKN ACTEGSIRYL GKEILGIDEE ELRGLRGKAI GMIPQNPATS       120
     LNPLMKIGIQ VMEIIRLHKK CNKSAAKHET INLFSRLRLP DPTTSICCYP HQLSGGMRQR       180
     VLISMGIACN PGLILVDEPT KGLDAVLRKR VVDLLKEQVS SSTSSMLLIT HDFSVAAALA       240
     DRVAVMYAGE IVETGPVSQI LNHSRHPYTK SLLNSLPGRG FNSIPGFSPS LTNLPPGCKF       300
     QPRCKTSSSR CAAHHPDMEE ILTNHFVRCF HAHRS                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page