(data stored in ACNUC7421 zone)

EMBL: CP001720.PE414

CP001720.PE414       Location/Qualifiers
FT   CDS             complement(464202..465065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bar:GBAA4731 oligopeptide
FT                   ABC transporter, oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61379"
FT                   /db_xref="GOA:C8W527"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W527"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61379.1"
FT                   /translation="MKELVTVFTNCKETLKSNRMLSSSATVVVFIFLLALAGQWIMPHD
FT                   PAAVSLADKVQPPSFKYPFGTDSLGRCIFSRVIEGTHTSLSTAAIVVAISGISGVLIGL
FT                   ISGYFGGILDSLIMRTVDVMLAFPGIILSLALIAAIGPGLSSIIIALTMVHWTGYTRLI
FT                   RGEVLSVKQSEFVEAARAMGNSQISIMFKYILPSIVTPVIVMAALDIAHVVLAGASLSF
FT                   LGLGAQPPTAEWGAMINEGREFIRTAPHITLFPGLAVMITVLAFNMLGDSLRDVLDPRL
FT                   REGQIE"
     MKELVTVFTN CKETLKSNRM LSSSATVVVF IFLLALAGQW IMPHDPAAVS LADKVQPPSF        60
     KYPFGTDSLG RCIFSRVIEG THTSLSTAAI VVAISGISGV LIGLISGYFG GILDSLIMRT       120
     VDVMLAFPGI ILSLALIAAI GPGLSSIIIA LTMVHWTGYT RLIRGEVLSV KQSEFVEAAR       180
     AMGNSQISIM FKYILPSIVT PVIVMAALDI AHVVLAGASL SFLGLGAQPP TAEWGAMINE       240
     GREFIRTAPH ITLFPGLAVM ITVLAFNMLG DSLRDVLDPR LREGQIE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page