(data stored in ACNUC7421 zone)

EMBL: CP001720.PE415

CP001720.PE415       Location/Qualifiers
FT   CDS             complement(465067..466017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0449"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: noc:Noc_2185 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61380"
FT                   /db_xref="GOA:C8W528"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W528"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61380.1"
FT                   /translation="MWQFLFKRLAAAILVVAAASMLTFGILHLTPGDTPVTILKHAFIG
FT                   IEQEPTDSEVTNITNRYKLDEPLDKQYFSWIKEAVRGNLGESYVYRTSVAQIIGLRFPA
FT                   TVLLALVSVALSLLIAIPVGVFSAARRNSVFDHLSRLCALFAVSIPSFWLALLLIIVFS
FT                   LQLDLFSVAGFRQISDVVLPCVTIAAGMSAVTMRMMRSCMLEILNQDYILTAKAKGLHE
FT                   SVVVWRHALRNAFLPVITIVGLQFGHMLGGTVVVETVFAWPGLGKLLIDSILAKDIPMV
FT                   QGIIVLIATSYAVVNLLVDLAYVLMDPRIRYGREV"
     MWQFLFKRLA AAILVVAAAS MLTFGILHLT PGDTPVTILK HAFIGIEQEP TDSEVTNITN        60
     RYKLDEPLDK QYFSWIKEAV RGNLGESYVY RTSVAQIIGL RFPATVLLAL VSVALSLLIA       120
     IPVGVFSAAR RNSVFDHLSR LCALFAVSIP SFWLALLLII VFSLQLDLFS VAGFRQISDV       180
     VLPCVTIAAG MSAVTMRMMR SCMLEILNQD YILTAKAKGL HESVVVWRHA LRNAFLPVIT       240
     IVGLQFGHML GGTVVVETVF AWPGLGKLLI DSILAKDIPM VQGIIVLIAT SYAVVNLLVD       300
     LAYVLMDPRI RYGREV                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page