(data stored in ACNUC7421 zone)

EMBL: CP001720.PE417

CP001720.PE417       Location/Qualifiers
FT   CDS             complement(467918..468610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0451"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: net:Neut_1733 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61382"
FT                   /db_xref="GOA:C8W530"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W530"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61382.1"
FT                   /translation="MMQQDRLYDIWWQNLEEGEQQMEERHLRGWKEVINLIQEQDLSDM
FT                   TVLDFGCNQGGFLRHLYQVKPFKEGMGIDLAQQSIAVANSRKGDLPLTYVATNTPEQYT
FT                   NKFNLAVSQAVIYLIKDLKSHAWKIKQMLKPGGVYYATYTDLNDNPSLQHFTIWINENS
FT                   LVESNAHTLDFIAETFASEGFNVEIQRRHPQGFIDVSRKKDGFLRIADRMKATYEQAYI
FT                   FRFVLTDK"
     MMQQDRLYDI WWQNLEEGEQ QMEERHLRGW KEVINLIQEQ DLSDMTVLDF GCNQGGFLRH        60
     LYQVKPFKEG MGIDLAQQSI AVANSRKGDL PLTYVATNTP EQYTNKFNLA VSQAVIYLIK       120
     DLKSHAWKIK QMLKPGGVYY ATYTDLNDNP SLQHFTIWIN ENSLVESNAH TLDFIAETFA       180
     SEGFNVEIQR RHPQGFIDVS RKKDGFLRIA DRMKATYEQA YIFRFVLTDK                  230
//

If you have problems or comments...

PBIL Back to PBIL home page