(data stored in ACNUC7421 zone)

EMBL: CP001720.PE422

CP001720.PE422       Location/Qualifiers
FT   CDS             473209..473613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0456"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   acr:Acry_3301 transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61387"
FT                   /db_xref="GOA:C8VVY0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVY0"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACV61387.1"
FT                   /translation="MSKLDTNSHSVFLLTYHLILVVKYRRKVINDTIANRIKEIGEYIA
FT                   PKYNISFLEYNHDKDHTRILFKAHPNTEISKYINAFKSASSRLIKKEFPEVRKQLWKEY
FT                   FWSQSFCLLTTGGAPIEVIKKYIETQGEKR"
     MSKLDTNSHS VFLLTYHLIL VVKYRRKVIN DTIANRIKEI GEYIAPKYNI SFLEYNHDKD        60
     HTRILFKAHP NTEISKYINA FKSASSRLIK KEFPEVRKQL WKEYFWSQSF CLLTTGGAPI       120
     EVIKKYIETQ GEKR                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page