(data stored in ACNUC7421 zone)

EMBL: CP001720.PE423

CP001720.PE423       Location/Qualifiers
FT   CDS             473619..474710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0457"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0388
FT                   IS891/IS1136/IS1341 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61388"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C8W536"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61388.1"
FT                   /translation="MQIVYRFEMRPTKEQQKKMFHTLKLCRKLYNWSLSERQRVYKETG
FT                   QGLTYNKQQNMLPGYTKEHLEYKQVHSQVMQDTLRRVDFAYQRFFAKEAGYPRFKNRDH
FT                   YTSFTYPQVDAVKKTFSKPGKIYLSKIGFVKMTTHREFDASQISRVNIKYHGGKWYANL
FT                   TAEVEVLENLIDSTKSIGIDVGLEHFAVLSDSTEIGTPKYYRKSERKLAKQQRRLSRKK
FT                   KGSNNRGKAKTKVAKLHAKITNQRKDFLHKASLDVVQSHDIVFMEDLKSKNMVKNHYLA
FT                   KSIHDASWGTFRNFVEYKCHRYGKIFLPVPPHGTSQTCLCGANVPKDLSVRVHRCPACG
FT                   MVMPRDLVSAILIERRGLEMLAA"
     MQIVYRFEMR PTKEQQKKMF HTLKLCRKLY NWSLSERQRV YKETGQGLTY NKQQNMLPGY        60
     TKEHLEYKQV HSQVMQDTLR RVDFAYQRFF AKEAGYPRFK NRDHYTSFTY PQVDAVKKTF       120
     SKPGKIYLSK IGFVKMTTHR EFDASQISRV NIKYHGGKWY ANLTAEVEVL ENLIDSTKSI       180
     GIDVGLEHFA VLSDSTEIGT PKYYRKSERK LAKQQRRLSR KKKGSNNRGK AKTKVAKLHA       240
     KITNQRKDFL HKASLDVVQS HDIVFMEDLK SKNMVKNHYL AKSIHDASWG TFRNFVEYKC       300
     HRYGKIFLPV PPHGTSQTCL CGANVPKDLS VRVHRCPACG MVMPRDLVSA ILIERRGLEM       360
     LAA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page