(data stored in ACNUC7421 zone)

EMBL: CP001720.PE427

CP001720.PE427       Location/Qualifiers
FT   CDS             478038..478385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61392"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:C8W540"
FT                   /inference="similar to AA sequence:KEGG:Acid_6254"
FT                   /protein_id="ACV61392.1"
FT                   /translation="MTNERVYKMAFSTVYPLLVQKAERKGRIKSEVDAVICWLTGYDDS
FT                   GLQVQIVKNVDYETFFNEAPQINPNAAKISGVICGHRVEEIKDPLMQKIRWLDKLVDEL
FT                   AKGKPVEKVLR"
     MTNERVYKMA FSTVYPLLVQ KAERKGRIKS EVDAVICWLT GYDDSGLQVQ IVKNVDYETF        60
     FNEAPQINPN AAKISGVICG HRVEEIKDPL MQKIRWLDKL VDELAKGKPV EKVLR            115
//

If you have problems or comments...

PBIL Back to PBIL home page