(data stored in ACNUC7421 zone)

EMBL: CP001720.PE43

CP001720.PE43        Location/Qualifiers
FT   CDS             46902..48671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0045"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="TIGRFAM: indolepyruvate ferredoxin oxidoreductase,
FT                   alpha subunit; PFAM: thiamine pyrophosphate protein domain
FT                   protein TPP-binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: geo:Geob_2794 indolepyruvate
FT                   ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61008"
FT                   /db_xref="GOA:C8VVD8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD8"
FT                   /inference="protein motif:TFAM:TIGR03336"
FT                   /protein_id="ACV61008.1"
FT                   /translation="MKDLLSGNAAIARGAYEAGVKLGVGYPGTPSTEILENFAKYEGIY
FT                   AQWSPNEKVALEVGIGASLAGVRVLVTMKHVGVNVAADPLLTFAYTGVNGGLVLLSADD
FT                   PGMHSSQNEQDNRIFAKFAKIPMLEPSDSQEAKDMVGLALEISEKYDTPVLLRTTTRVA
FT                   HSQSMTEIGERREVIDKPYQKNAQKYVMVPGHGRMRRYFIENRMKDLAEYSEKTPVNFT
FT                   IPGDQKIGVITSGISYQYVREVLPDVSVLKLGMTFPLPEQMIKDFAGQVEKLYVVEELE
FT                   PFIEEQLKIWGIEVLGKQVFPSIGEFSADLIRQKFVDEKIIDASEKIAAVPEQTAPATP
FT                   VRPPVQCPGCPHRGVFYTLNRLKLVVTGDIGCYTLGALPPLQAMDTTVCMGASISMALG
FT                   MEKAVPEMKGKTVAVIGDSTFFHSGITGLVDVVYNQGNSTVIILDNRTTAMTGHQENPS
FT                   TGINLMGQPAPVIDIEKLARALGINRVTKVDPLSLEEFKNVVQQEIAADEPSVIIAQRP
FT                   CELLVKEKAAPYVVDPDVCKGCKQCQRLGCPAMSFNKLEKKAVIDIITCVGCGLCVQIC
FT                   KHGALRQGGERNE"
     MKDLLSGNAA IARGAYEAGV KLGVGYPGTP STEILENFAK YEGIYAQWSP NEKVALEVGI        60
     GASLAGVRVL VTMKHVGVNV AADPLLTFAY TGVNGGLVLL SADDPGMHSS QNEQDNRIFA       120
     KFAKIPMLEP SDSQEAKDMV GLALEISEKY DTPVLLRTTT RVAHSQSMTE IGERREVIDK       180
     PYQKNAQKYV MVPGHGRMRR YFIENRMKDL AEYSEKTPVN FTIPGDQKIG VITSGISYQY       240
     VREVLPDVSV LKLGMTFPLP EQMIKDFAGQ VEKLYVVEEL EPFIEEQLKI WGIEVLGKQV       300
     FPSIGEFSAD LIRQKFVDEK IIDASEKIAA VPEQTAPATP VRPPVQCPGC PHRGVFYTLN       360
     RLKLVVTGDI GCYTLGALPP LQAMDTTVCM GASISMALGM EKAVPEMKGK TVAVIGDSTF       420
     FHSGITGLVD VVYNQGNSTV IILDNRTTAM TGHQENPSTG INLMGQPAPV IDIEKLARAL       480
     GINRVTKVDP LSLEEFKNVV QQEIAADEPS VIIAQRPCEL LVKEKAAPYV VDPDVCKGCK       540
     QCQRLGCPAM SFNKLEKKAV IDIITCVGCG LCVQICKHGA LRQGGERNE                   589
//

If you have problems or comments...

PBIL Back to PBIL home page